KEGG   Homo sapiens (human): 79068
Entry
79068             CDS       T01001                                 

Gene name
FTO, ALKBH9, BMIQ14, GDFD
Definition
(RefSeq) FTO alpha-ketoglutarate dependent dioxygenase
  KO
K19469  mRNA N6-methyladenine demethylase [EC:1.14.11.53]
Organism
hsa  Homo sapiens (human)
Disease
H00409  Type 2 diabetes mellitus
H00926  Growth retardation, developmental delay, coarse facies, and early death
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    79068 (FTO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.53  mRNA N6-methyladenine demethylase
     79068 (FTO)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     79068 (FTO)
SSDB
Motif
Pfam: FTO_NTD FTO_CTD
Other DBs
NCBI-GeneID: 79068
NCBI-ProteinID: NP_001073901
OMIM: 610966
HGNC: 24678
Ensembl: ENSG00000140718
Vega: OTTHUMG00000158780
Pharos: Q9C0B1(Tbio)
UniProt: Q9C0B1 B3KU60 Q99770
Structure
PDB: 

Position
16q12.2
AA seq 505 aa
MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEE
LHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPV
KGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVG
MGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRS
AVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIPLHQGDCYFMLDD
LNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVDNDDVSLKSFE
PAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDD
ASMPLPFDLTDIVSELRGQLLEAKP
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaagcgcaccccgactgccgaggaacgagagcgcgaagctaagaaactgaggcttctt
gaagagcttgaagacacttggctcccttatctgacccccaaagatgatgaattctatcag
cagtggcagctgaaatatcctaaactaattctccgagaagccagcagtgtatctgaggag
ctccataaagaggttcaagaagcctttctcacactgcacaagcatggctgcttatttcgg
gacctggttaggatccaaggcaaagatctgctcactccggtatctcgcatcctcattggt
aatccaggctgcacctacaagtacctgaacaccaggctctttacggtcccctggccagtg
aaagggtctaatataaaacacaccgaggctgaaatagccgctgcttgtgagaccttcctc
aagctcaatgactacctgcagatagaaaccatccaggctttggaagaacttgctgccaaa
gagaaggctaatgaggatgctgtgccattgtgtatgtctgcagatttccccagggttggg
atgggttcatcctacaacggacaagatgaagtggacattaagagcagagcagcatacaac
gtaactttgctgaatttcatggatcctcagaaaatgccatacctgaaagaggaaccttat
tttggcatggggaaaatggcagtgagctggcatcatgatgaaaatctggtggacaggtca
gcggtggcagtgtacagttatagctgtgaaggccctgaagaggaaagtgaggatgactct
catctcgaaggcagggatcctgatatttggcatgttggttttaagatctcatgggacata
gagacacctggtttggcgataccccttcaccaaggagactgctatttcatgcttgatgat
ctcaatgccacccaccaacactgtgttttggccggttcacaacctcggtttagttccacc
caccgagtggcagagtgctcaacaggaaccttggattatattttacaacgctgtcagttg
gctctgcagaatgtctgtgacgatgtggacaatgatgatgtctctttgaaatcctttgag
cctgcagttttgaaacaaggagaagaaattcataatgaggtcgagtttgagtggctgagg
cagttttggtttcaaggcaatcgatacagaaagtgcactgactggtggtgtcaacccatg
gctcaactggaagcactgtggaagaagatggagggtgtgacaaatgctgtgcttcatgaa
gttaaaagagaggggctccccgtggaacaaaggaatgaaatcttgactgccatccttgcc
tcgctcactgcacgccagaacctgaggagagaatggcatgccaggtgccagtcacgaatt
gcccgaacattacctgctgatcagaagccagaatgtcggccatactgggaaaaggatgat
gcttcgatgcctctgccgtttgacctcacagacatcgtttcagaactcagaggtcagctt
ctggaagcaaaaccctag

DBGET integrated database retrieval system