KEGG   Homo sapiens (human): 79071Help
Entry
79071             CDS       T01001                                 

Gene name
ELOVL6, FACE, FAE, LCE
Definition
(RefSeq) ELOVL fatty acid elongase 6
  KO
K10203  elongation of very long chain fatty acids protein 6 [EC:2.3.1.199]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01212  Fatty acid metabolism
Module
hsa_M00415  Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    79071 (ELOVL6)
   01040 Biosynthesis of unsaturated fatty acids
    79071 (ELOVL6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     79071 (ELOVL6)
Lipid biosynthesis proteins [BR:hsa01004]
 Elongase
  PUFA
   79071 (ELOVL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 79071
NCBI-ProteinID: NP_001124193
OMIM: 611546
HGNC: 15829
Ensembl: ENSG00000170522
Vega: OTTHUMG00000132547
Pharos: Q9H5J4(Tchem)
UniProt: Q9H5J4 A0A024RDK5
Position
4q25
AA seq 265 aa AA seqDB search
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
KPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSK
APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY
YALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYL
SYLVLFCHFFFEAYIGKMRKTTKAE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtcagtgttgactttacaagaatatgaattcgaaaagcagttcaacgagaat
gaagccatccaatggatgcaggaaaactggaagaaatctttcctgttttctgctctgtat
gctgcctttatattcggtggtcggcacctaatgaataaacgagcaaagtttgaactgagg
aagccattagtgctctggtctctgacccttgcagtcttcagtatattcggtgctcttcga
actggtgcttatatggtgtacattttgatgaccaaaggcctgaagcagtcagtttgtgac
cagggtttttacaatggacctgtcagcaaattctgggcttatgcatttgtgctaagcaaa
gcacccgaactaggagatacaatattcattattctgaggaagcagaagctgatcttcctg
cactggtatcaccacatcactgtgctcctgtactcttggtactcctacaaagacatggtt
gccgggggaggttggttcatgactatgaactatggcgtgcacgccgtgatgtactcttac
tatgccttgcgggcggcaggtttccgagtctcccggaagtttgccatgttcatcaccttg
tcccagatcactcagatgctgatgggctgtgtggttaactacctggtcttctgctggatg
cagcatgaccagtgtcactctcactttcagaacatcttctggtcctcactcatgtacctc
agctaccttgtgctcttctgccatttcttctttgaggcctacatcggcaaaatgaggaaa
acaacgaaagctgaatag

DBGET integrated database retrieval system