KEGG   Homo sapiens (human): 79073Help
Entry
79073             CDS       T01001                                 

Gene name
TMEM109
Definition
(RefSeq) transmembrane protein 109
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BRI3BP PEP-CTERM
Motif
Other DBs
NCBI-GeneID: 79073
NCBI-ProteinID: NP_076997
HGNC: 28771
Ensembl: ENSG00000110108
Vega: OTTHUMG00000167801
Pharos: Q9BVC6(Tbio)
UniProt: Q9BVC6
Position
11q12.2
AA seq 243 aa AA seqDB search
MAASSISSPWGKHVFKAILMVLVALILLHSALAQSRRDFAPPGQQKREAPVDVLTQIGRS
VRGTLDAWIGPETMHLVSESSSQVLWAISSAISVAFFALSGIAAQLLNALGLAGDYLAQG
LKLSPGQVQTFLLWGAGALVVYWLLSLLLGLVLALLGRILWGLKLVIFLAGFVALMRSVP
DPSTRALLLLALLILYALLSRLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSV
EEE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctccagcatcagttcaccatggggaaagcatgtgttcaaagccattctgatg
gtcctagtggcccttatcctcctccactcagcattggcccagtcccgtcgagactttgca
ccaccaggccaacagaagagagaagccccagttgatgtcttgacccagataggtcgatct
gtgcgagggacactggatgcctggattgggccagagaccatgcacctggtgtcagagtct
tcgtcccaagtgttgtgggccatctcatcagccatttctgtggccttctttgctctgtct
gggatcgccgcacagctgctgaatgccttgggactagctggtgattacctcgcccagggc
ctgaagctcagccctggccaggtccagaccttcctgctgtggggagcaggggccctggtc
gtctactggctgctgtctctgctcctcggcttggtcttggccttgctggggcggatcctg
tggggcctgaagcttgtcatcttcctggccggcttcgtggccctgatgaggtcggtgcct
gacccttccacccgggccctgctactcctggccttgctgatcctctacgccctgctgagc
cggctcactggctcccgagcctctggggcccaactcgaggccaaggtgcgagggctggaa
cgccaggtggaggagctgcgctggcgccagaggcgagcggccaagggggcccgcagtgtg
gaggaggagtga

DBGET integrated database retrieval system