KEGG   Homo sapiens (human): 79074Help
Entry
79074             CDS       T01001                                 

Gene name
C2orf49, asw
Definition
(RefSeq) chromosome 2 open reading frame 49
  KO
K15432  ashwin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    79074 (C2orf49)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing ligases
    79074 (C2orf49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ashwin
Motif
Other DBs
NCBI-GeneID: 79074
NCBI-ProteinID: NP_076998
HGNC: 28772
Ensembl: ENSG00000135974
Vega: OTTHUMG00000130808
Pharos: Q9BVC5(Tbio)
UniProt: Q9BVC5
Position
2q12.2
AA seq 232 aa AA seqDB search
MAGDVGGRSCTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPL
PQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPLIVFDGSSTSTSIKVKKTEN
GDNDRLKPPPQASFTSNAFRKLSNSSSSVSPLILSSNLPVNNKTEHNNNDAKQNHDLTHR
KSPSGPVKSPPLSPVGTTPVKLKRAAPKEEAEAMNNLKPPQAKRKIQHVTWP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggatgtgggcggtcgcagctgcacggactcggaactgctgctgcacccggag
ctgctgtcccaggagttccttctcctcactctggagcagaagaacatagctgttgaaact
gatgtaagagtaaacaaagacagtcttactgacctttatgtccaacatgcaataccattg
cctcagagggatttgccgaagaatagatgggggaaaatgatggaaaagaaaagagaacaa
catgagattaaaaatgagactaaaaggagtagcactgtagatgggttaaggaaaagaccc
ctcatcgtatttgatggaagttcaacaagtacaagcataaaagtgaaaaagacagagaat
ggagataatgatcgactgaagcctcccccgcaggcaagctttaccagtaatgcctttaga
aaattatcaaattcctcttcgagtgtttcacccctaattttgtcttccaatttgcctgtg
aacaataaaacggaacacaataataatgacgctaaacagaaccatgacttaacgcatagg
aaaagtccttcaggccctgtgaagtcgccaccattgtcccctgttggaactactccagtg
aagttaaagagagctgctcctaaagaagaggcagaggccatgaataacctgaagccccca
caagcaaaaaggaagatacaacatgttacttggccctga

DBGET integrated database retrieval system