KEGG   Homo sapiens (human): 79085
Entry
79085             CDS       T01001                                 

Gene name
SLC25A23, APC2, MCSC2, SCaMC-3
Definition
(RefSeq) solute carrier family 25 member 23
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    79085 (SLC25A23)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   79085 (SLC25A23)
SSDB
Motif
Pfam: Mito_carr EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 SPARC_Ca_bdg EF-hand_9 Caleosin
Other DBs
NCBI-GeneID: 79085
NCBI-ProteinID: NP_077008
OMIM: 608746
HGNC: 19375
Ensembl: ENSG00000125648
Vega: OTTHUMG00000180852
Pharos: Q9BV35(Tbio)
UniProt: Q9BV35
Position
19p13.3
AA seq 468 aa
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS
LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK
NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG
LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcgggggagcccgggcgacgcggagcggcggcagcgctggggtcgcctgttcgaggag
ctggacagtaacaaggatggccgcgtggacgtgcacgagttgcgccaggggctggccagg
ctgggcgggggcaacccagaccccggcgcccaacagggtatctcctctgagggtgatgct
gacccagatggcgggctcgacctggaggaattttcccgctatctgcaggagcgggaacag
cgtctgctgctcatgtttcacagtcttgaccggaaccaggatggtcacattgatgtctct
gagatccaacagagtttccgagctctgggcatttccatctcgctggagcaggctgagaaa
attttgcacagcatggaccgagacggcacaatgaccattgactggcaagaatggcgcgac
cacttcctgttgcattcgctggaaaatgtggaggacgtgctgtatttctggaagcattcc
acggtcctggacattggcgagtgcctgacagtgccggacgagttctcaaagcaagagaag
ctgacgggcatgtggtggaaacagctggtggccggcgcagtggcaggtgccgtgtcacgg
acaggcacggcccctctggaccgcctcaaggtcttcatgcaggtccatgcctcaaagacc
aaccggctgaacatccttggggggcttcgaagcatggtccttgagggaggcatccgctcc
ctgtggcgcggcaatggtattaatgtactcaagattgcccccgagtcagctatcaagttc
atggcctatgaacagatcaagagggccatcctggggcagcaggagacactgcatgtgcag
gagcgcttcgtggctggctccctggctggtgccacagcccaaaccatcatttaccctatg
gaggtgctgaagacgcggctgaccttgcgccggacgggccagtataaggggctgctggac
tgcgccaggcgtatcctggagagggaggggccccgtgccttctaccgcggctacctcccc
aacgtgctgggcatcatcccctatgcgggcatcgacctggccgtctacgagactctgaag
aactggtggcttcagcagtacagccacgactcggcagacccaggcatcctcgtgctcctg
gcctgcggtaccatatccagcacctgcggccagatagccagttacccgctggccctggtc
cggacccgcatgcaggcacaagcctccatcgagggtggcccccagctgtccatgctgggt
ctgctacgtcacatcctgtcccaggagggcatgcggggcctctaccgggggatcgccccc
aacttcatgaaggttattccagctgtgagcatctcctatgtggtctacgagaacatgaag
caggccttgggggtcacgtccaggtga

DBGET integrated database retrieval system