KEGG   Homo sapiens (human): 79090Help
Entry
79090             CDS       T01001                                 

Gene name
TRAPPC6A, TRS33
Definition
(RefSeq) trafficking protein particle complex 6A
  KO
K20304  trafficking protein particle complex subunit 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79090 (TRAPPC6A)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    79090 (TRAPPC6A)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    79090 (TRAPPC6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAPP
Motif
Other DBs
NCBI-GeneID: 79090
NCBI-ProteinID: NP_001257820
OMIM: 610396
HGNC: 23069
Ensembl: ENSG00000007255
Vega: OTTHUMG00000181775
Pharos: O75865(Tdark)
UniProt: O75865 B7TZ90
Structure
PDB: 

Position
19q13.32
AA seq 159 aa AA seqDB search
MADTVLFEFLHTEMVAELWAHDPDPGPGGQKMSLSVLEGMGFRVGQALGERLPRETLAFR
EELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFL
AFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcggatactgtgttgtttgagtttcttcacacggagatggtggctgagctgtgggct
cacgaccccgaccccggcccggggggacagaagatgagcctgtcggtcctggagggtatg
gggttccgtgtgggccaggctctaggcgagaggctgccccgggagacgctggccttcagg
gaggagctggatgtcctcaagttcttgtgcaaagacctgtgggtggcggtgttccagaag
cagatggacagcctgcgcaccaatcaccaggggacctacgtcctgcaagacaacagcttc
cccctcctcctcccgatggcctctggcctgcagtatctggaggaagcacccaagttcctg
gccttcacctgcggcctcctgcgcggcgccctctataccctgggcattgagagcgtggtc
accgcctccgtggcagccctgcccgtctgtaagttccaggtggtgattccgaaatcctaa

DBGET integrated database retrieval system