KEGG   Homo sapiens (human): 79095
Entry
79095             CDS       T01001                                 

Symbol
BBLN, C9orf16, EST00098
Name
(RefSeq) bublin coiled coil protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UPF0184 EzrA PhaP_Bmeg ATP-synt_D UPF0242 T3SSipB
Other DBs
NCBI-GeneID: 79095
NCBI-ProteinID: NP_077017
HGNC: 17823
Ensembl: ENSG00000171159
Vega: OTTHUMG00000020731
Pharos: Q9BUW7(Tdark)
UniProt: Q9BUW7
Position
9q34.11
AA seq 83 aa
MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELL
ESNRQTRLEFQQQLGEAPSDASP
NT seq 252 nt   +upstreamnt  +downstreamnt
atgtcgggccccaacggagacctggggatgccggtggaggcgggagcggaaggcgaggag
gacggcttcggggaagcagaatacgctgccatcaactccatgctggaccagatcaactcc
tgtctggaccacctggaggagaagaatgaccacctccacgcccgcctccaggagctgctg
gagtccaaccggcagacacgcctggagttccagcagcagctcggggaggcccccagtgat
gccagcccctag

DBGET integrated database retrieval system