KEGG   Homo sapiens (human): 790955
Entry
790955            CDS       T01001                                 
Symbol
UQCC3, C11orf83, CCDS41658.1, MC3DN9, UNQ655
Name
(RefSeq) ubiquinol-cytochrome c reductase complex assembly factor 3
  KO
K23165  ubiquinol-cytochrome-c reductase complex assembly factor 3
Organism
hsa  Homo sapiens (human)
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    790955 (UQCC3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-III assembly factors
    790955 (UQCC3)
SSDB
Motif
Pfam: UQCC3
Other DBs
NCBI-GeneID: 790955
NCBI-ProteinID: NP_001078841
OMIM: 616097
HGNC: 34399
Ensembl: ENSG00000204922
Pharos: Q6UW78(Tbio)
UniProt: Q6UW78
Position
11:62671673..62673686
AA seq 93 aa
MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLL
LATLQEAATTQENVAWRKNWMVGGEGGAGGRSP
NT seq 282 nt   +upstreamnt  +downstreamnt
atggattccttgcggaaaatgctgatctcagtcgcaatgctgggcgcaggggctggcgtg
ggctacgcgctcctcgttatcgtgaccccgggagagcggcggaagcaggaaatgctaaag
gagatgccactgcaggacccaaggagcagggaggaggcggccaggacccagcagctattg
ctggccactctgcaggaggcagcgaccacgcaggagaacgtggcctggaggaagaactgg
atggttggcggcgaaggcggcgccggcgggaggtcaccgtga

DBGET integrated database retrieval system