KEGG   Homo sapiens (human): 79098Help
Entry
79098             CDS       T01001                                 

Gene name
C1orf116, SARG
Definition
(RefSeq) chromosome 1 open reading frame 116
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SARG
Motif
Other DBs
NCBI-GeneID: 79098
NCBI-ProteinID: NP_076427
OMIM: 611680
HGNC: 28667
Ensembl: ENSG00000182795
Vega: OTTHUMG00000036580
Pharos: Q9BW04(Tdark)
UniProt: Q9BW04
Position
1q32.1
AA seq 601 aa AA seqDB search
MPERELWPAGTGSEPVTRVGSCDSMMSSTSTRSGSSDSSYDFLSTEEKECLLFLEETIGS
LDTEADSGLSTDESEPATTPRGFRALPITQPTPRGGPEETITQQGRTPRTVTESSSSHPP
EPQGLGLRSGSYSLPRNIHIARSQNFRKSTTQASSHNPGEPGRLAPEPEKEQVSQSSQPR
QAPASPQEAALDLDVVLIPPPEAFRDTQPEQCREASLPEGPGQQGHTPQLHTPSSSQERE
QTPSEAMSQKAKETVSTRYTQPQPPPAGLPQNARAEDAPLSSGEDPNSRLAPLTTPKPRK
LPPNIVLKSSRSSFHSDPQHWLSRHTEAAPGDSGLISCSLQEQRKARKEALEKLGLPQDQ
DEPGLHLSKPTSSIRPKETRAQHLSPAPGLAQPAAPAQASAAIPAAGKALAQAPAPAPGP
AQGPLPMKSPAPGNVAASKSMPISIPKAPRANSALTPPKPESGLTLQESNTPGLRQMNFK
SNTLERSGVGLSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFA
GIQVGKLADLEQEQSSKRLSYQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLLK
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagagggagctgtggccagcggggactggctcagaacccgtgacccgtgtcggc
agctgtgacagcatgatgagcagcacctccacccgctctggatctagtgatagcagctac
gacttcctgtccactgaagagaaggagtgtctgctcttcctggaggagaccattggctca
ctggacacggaggctgacagcggactgtccactgacgagtctgagccagccacaactccc
agaggtttccgagcactgcccataacccaacccactccccggggaggtccagaggagacc
atcactcagcaaggacgaacgccaaggacagtaactgagtccagctcatcccaccctcct
gagccccagggcctaggcctcaggtctggctcctacagcctccctaggaatatccacatt
gccagaagccagaacttcaggaaaagcaccacccaggctagcagtcacaaccctggagaa
ccggggaggcttgcgccagagcctgagaaagaacaggtcagccagagcagccaacccagg
caggcacctgccagcccccaggaggctgcccttgacttggacgtggtgctcatccctccg
ccagaagctttccgggacacccagccagagcagtgtagggaagccagcctgcccgagggg
ccaggacagcagggccacacaccccagctccacacaccatccagctcccaggaaagagag
cagactccttcagaagccatgtcccaaaaagccaaggaaacagtctcaaccaggtacaca
caaccccagcctcctcctgcagggttgcctcagaatgcaagagctgaagatgctcccctc
tcatcaggggaggacccaaacagccgactagctcccctcacaacccctaagccccggaag
ctgccacctaatattgttctgaagagcagccgaagcagtttccacagtgacccccagcac
tggctgtcccgccacactgaggctgcccctggagattctggcctgatctcctgttcactg
caagagcagagaaaagcacgtaaagaagctctagagaagctggggctaccccaggatcaa
gatgagcctggactccacttaagtaagcccaccagctccatcagacccaaggagacacgg
gcccagcatctgtccccagctccaggtctggctcagcctgcagctccagcccaggcctca
gcagctattcctgctgctgggaaggctctggctcaagctccggctccagctccaggtcca
gctcagggacctttgccaatgaagtctccagctccaggcaatgttgcagctagcaaatct
atgccaatttctatccctaaggccccaagggcaaacagtgccctgactccaccgaagcca
gagtcagggctgactctccaggagagcaacacccctggcctgagacagatgaacttcaag
tccaacactctggagcgctcaggcgtgggactgagcagctacctttcaactgagaaagat
gccagccccaaaaccagcacttctctgggaaagggctccttcttggacaagatctcgccc
agtgtcttacgtaattctcggccccgcccggcctccctgggcacggggaaagattttgca
ggtatccaggtaggcaagctggctgacctggagcaggagcagagctccaagcgcctgtcc
taccaaggacagagccgtgacaagcttcctcgccccccctgtgtcagtgtcaagatctcc
ccaaagggtgtccccaatgaacacagaagggaggccctgaagaagctgggactgttgaag
gagtag

DBGET integrated database retrieval system