KEGG   Homo sapiens (human): 79109Help
Entry
79109             CDS       T01001                                 

Gene name
MAPKAP1, JC310, MIP1, SIN1, SIN1b, SIN1g
Definition
(RefSeq) MAPK associated protein 1
  KO
K20410  target of rapamycin complex 2 subunit MAPKAP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    79109 (MAPKAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CRIM SIN1 SIN1_PH VPS9 E3_UbLigase_RBR
Motif
Other DBs
NCBI-GeneID: 79109
NCBI-ProteinID: NP_001006618
OMIM: 610558
HGNC: 18752
Ensembl: ENSG00000119487
Vega: OTTHUMG00000020683
Pharos: Q9BPZ7(Tbio)
UniProt: Q9BPZ7
Structure
PDB: 

Position
9q33.3
AA seq 522 aa AA seqDB search
MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGE
TQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQEL
KSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVY
LPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGE
VDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVT
MKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRAD
GVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS
TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVL
KVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttggacaatccaactatcattctagctcatattcgacagtcacatgtgacc
agtgatgacacgggaatgtgtgagatggttctcattgatcatgatgttgacctagagaag
attcatcctccttcaatgcctggagacagtgggtcagaaattcagggaagcaatggtgag
actcagggctatgtatatgcccagtcagtcgatattacctcaagttgggactttggtatt
agaagacgctcaaacacagctcaaagattagaacgactccgaaaagagagacaaaaccag
atcaaatgcaaaaatattcagtggaaagaaagaaattctaagcaatcagcccaggagtta
aagtcactgtttgaaaaaaaatctctcaaagagaagcctccaatttctgggaagcagtcg
atattatctgtacgcctagaacagtgccctctgcagctgaataacccttttaacgagtat
tccaaatttgatggcaagggtcatgtaggtacaacagcaaccaagaagatcgatgtctac
ctccctctgcactcgagccaggacagactgctgccaatgaccgtggtgacaatggccagc
gccagggtgcaggacctgatcgggctcatctgctggcagtatacaagcgaaggacgggag
ccgaagctcaatgacaatgtcagtgcctactgcctgcatattgctgaggatgatggggag
gtggacaccgatttccccccgctggattccaatgagcccattcataagtttggcttcagt
actttggccctggttgaaaagtactcatctcctggtctgacatccaaagagtcactcttt
gttcgaataaatgctgctcatggattctcccttattcaggtggacaacacaaaggttacc
atgaaggaaatcttactgaaggcagtgaagcgaagaaaaggatcccagaaagtttcaggc
cctcagtaccgcctggagaagcagagcgagcccaatgtcgccgttgacctggacagcact
ttggagagccagagcgcatgggagttctgcctggtccgcgagaacagttcaagggcagac
ggggtttttgaggaggattcgcaaattgacatagccacagtacaggatatgcttagcagc
caccattacaagtcattcaaagtcagcatgatccacagactgcgattcacaaccgacgta
cagctaggtatctctggagacaaagtagagatagaccctgttacgaatcagaaagccagc
actaagttttggattaagcagaaacccatctcaatcgattccgacctgctctgtgcctgt
gaccttgctgaagagaaaagccccagtcacgcaatatttaaactcacgtatctaagcaat
cacgactataaacacctctactttgaatcggacgctgctaccgtcaatgaaattgtgctc
aaggttaactacatcctggaatcgcgagctagcactgcccgggctgactactttgctcaa
aaacaaagaaaactgaacagacgtacgagcttcagcttccagaaggagaagaaatccggg
cagcagtga

DBGET integrated database retrieval system