KEGG   Homo sapiens (human): 79132Help
Entry
79132             CDS       T01001                                 

Gene name
DHX58, D11LGP2, D11lgp2e, LGP2, RLR-3
Definition
(RefSeq) DExH-box helicase 58
  KO
K12649  ATP-dependent RNA helicase DHX58 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    79132 (DHX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    79132 (DHX58)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     79132 (DHX58)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   79132 (DHX58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RIG-I_C-RD RIG-I_C Helicase_C ResIII DEAD SWI2_SNF2 AAA_19 Folliculin
Motif
Other DBs
NCBI-GeneID: 79132
NCBI-ProteinID: NP_077024
OMIM: 608588
HGNC: 29517
Ensembl: ENSG00000108771
Vega: OTTHUMG00000133493
Pharos: Q96C10(Tbio)
UniProt: Q96C10 A0A024R1Y5
Structure
PDB: 

Position
17q21.2
AA seq 678 aa AA seqDB search
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV
ELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDG
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQI
HDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQR
QFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYA
FVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQR
ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAENLSDLSLD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggagcttcggtcctaccaatgggaggtgatcatgcctgccctggagggcaagaatatc
atcatctggctgcccacgggtgccgggaagacccgggcggctgcttatgtggccaagcgg
cacctagagactgtggatggagccaaggtggttgtattggtcaacagggtgcacctggtg
acccagcatggtgaagagttcaggcgcatgctggatggacgctggaccgtgacaaccctg
agtggggacatgggaccacgtgctggctttggccacctggcccggtgccatgacctgctc
atctgcacagcagagcttctgcagatggcactgaccagccccgaggaggaggagcacgtg
gagctcactgtcttctccctgatcgtggtggatgagtgccaccacacgcacaaggacacc
gtctacaacgtcatcatgagccagtacctagaacttaaactccagagggcacagccgcta
ccccaggtgctgggtctcacagcctccccaggcactggcggggcctccaaactcgatggg
gccatcaaccacgtcctgcagctctgtgccaacttggacacgtggtgcatcatgtcaccc
cagaactgctgcccccagctgcaggagcacagccaacagccttgcaaacagtacaacctc
tgccacaggcgcagccaggatccgtttggggacttgctgaagaagctcatggaccaaatc
catgaccacctggagatgcctgagttgagccggaaatttgggacgcaaatgtatgagcag
caggtggtgaagctgagtgaggctgcggctttggctgggcttcaggagcaacgggtgtat
gcgcttcacctgaggcgctacaatgacgcgctgctcatccatgacaccgtccgcgccgtg
gatgccttggctgcgctgcaggatttctatcacagggagcacgtcactaaaacccagatc
ctgtgtgccgagcgccggctgctggccctgttcgatgaccgcaagaatgagctggcccac
ttggcaactcatggcccagagaatccaaaactggagatgctggaaaagatcctgcaaagg
cagttcagtagctctaacagccctcggggtatcatcttcacccgcacccgccaaagcgca
cactccctcctgctctggctccagcagcagcagggcctgcagactgtggacatccgggcc
cagctactgattggggctgggaacagcagccagagcacccacatgacccagagggaccag
caagaagtgatccagaagttccaagatggaaccctgaaccttctggtggccacgagtgtg
gcggaggaggggctggacatcccacattgcaatgtggtggtgcgttatgggctcttgacc
aatgaaatctccatggtccaggccaggggccgtgcccgggccgatcagagtgtatacgcg
tttgtagcaactgaaggtagccgggagctgaagcgggagctgatcaacgaggcgctggag
acgctgatggagcaggcagtggctgctgtgcagaaaatggaccaggccgagtaccaggcc
aagatccgggatctgcagcaggcagccttgaccaagcgggcggcccaggcagcccagcgg
gagaaccagcggcagcagttcccagtggagcacgtgcagctactctgcatcaactgcatg
gtggctgtgggccatggcagcgacctgcggaaggtggagggcacccaccatgtcaatgtg
aaccccaacttctcgaactactataatgtctccagggatcctgtggtcatcaacaaagtc
ttcaaggactggaagcctgggggtgtcatcagctgcaggaactgtggggaggtctggggt
ctgcagatgatctacaagtcagtgaagctgccagtgctcaaagtccgcagcatgctgctg
gagacccctcaggggcggatccaggccaaaaagtggtcccgcgtgcccttctccgtgcct
gactttgacttcctgcagcattgtgccgagaacttgtcggacctctccctggactga

DBGET integrated database retrieval system