KEGG   Homo sapiens (human): 79135
Entry
79135             CDS       T01001                                 

Gene name
APOO, FAM121B, MIC26, MICOS26, Mic23, My025
Definition
(RefSeq) apolipoprotein O
  KO
K24625  MICOS complex subunit MIC26
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    79135 (APOO)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MICOS complex
    79135 (APOO)
SSDB
Motif
Pfam: ApoO Mvb12 Apolipoprotein
Other DBs
NCBI-GeneID: 79135
NCBI-ProteinID: NP_077027
OMIM: 300753
HGNC: 28727
Ensembl: ENSG00000184831
Vega: OTTHUMG00000021259
Pharos: Q9BUR5(Tbio)
UniProt: Q9BUR5
Position
Xp22.11
AA seq 198 aa
MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
EESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFA
GLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDL
WKENFQKPGNVKNSPGTK
NT seq 597 nt   +upstreamnt  +downstreamnt
atgttcaaggtaattcagaggtccgtggggccagccagcctgagcttgctcaccttcaaa
gtctatgcagcaccaaaaaaggactcacctcccaaaaattccgtgaaggttgatgagctt
tcactctactcagttcctgagggtcaatcgaagtatgtggaggaggcaaggagccagctt
gaagaaagcatctcacagctccgacactattgcgagccatacacaacctggtgtcaggaa
acgtactcccaaactaagcccaagatgcaaagtttggttcaatgggggttagacagctat
gactatctccaaaatgcacctcctggattttttccgagacttggtgttattggttttgct
ggccttattggactccttttggctagaggttcaaaaataaagaagctagtgtatccgcct
ggtttcatgggattagctgcctccctctattatccacaacaagccatcgtgtttgcccag
gtcagtggggagagattatatgactggggtttacgaggatatatagtcatagaagatttg
tggaaggagaactttcaaaagccaggaaatgtgaagaattcacctggaactaagtag

DBGET integrated database retrieval system