KEGG   Homo sapiens (human): 79142Help
Entry
79142             CDS       T01001                                 

Gene name
PHF23, hJUNE-1b
Definition
(RefSeq) PHD finger protein 23
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PHD PHD_2 C1_1 TFIIE-A_C
Motif
Other DBs
NCBI-GeneID: 79142
NCBI-ProteinID: NP_077273
OMIM: 612910
HGNC: 28428
Ensembl: ENSG00000040633
Vega: OTTHUMG00000177972
Pharos: Q9BUL5(Tbio)
UniProt: Q9BUL5
Position
17p13.1
AA seq 403 aa AA seqDB search
MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKEESDWPAS
GSSSPLRGESAADSDGWDSAPSDLRTIQTFVKKAKSSKRRAAQAGPTQPGPPRSTFSRLQ
APDSATLLEKMKLKDSLFDLDGPKVASPLSPTSLTHTSRPPAALTPVPLSQGDLSHPPRK
KDRKNRKLGPGAGAGFGVLRRPRPTPGDGEKRSRIKKSKKRKLKKAERGDRLPPPGPPQA
PPSDTDSEEEEEEEEEEEEEEMATVVGGEAPVPVLPTPPEAPRPPATVHPEGVPPADSES
KEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAGRPMIECSLCG
TWIHLSCAKIKKTNVPDFFYCQKCKELRPEARRLGGPPKSGEP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagccatggcggagcccagtcccgaagatccacctccgacccttaagccagag
actcagccaccagagaaacggcggagaacaattgaggatttcaacaaattctgcagtttt
gttttggcatatgctggttacattccccctagcaaagaggaaagtgactggccagcctct
ggctccagctctccattgcgaggagagagtgcggccgacagtgatggctgggactcggcc
ccctcagatcttcgaaccatccagacttttgttaagaaagcaaagtcatccaagagaagg
gcagctcaagcaggtcccacccagccaggacccccaaggtccactttctctcgtctgcag
gcccccgacagtgctaccttgcttgagaagatgaagctcaaggactctctctttgatctg
gatgggcccaaagtggcatctcctttgtcccccacatccctgacacatacctcccggccc
cctgctgctcttacccccgtgcccctttcccagggggacctctcccatcctcctcgaaag
aaggaccgaaagaaccgaaagttggggccaggagctggggctggctttggggtgcttcgg
aggcctcggccaactcctggggatggggaaaagagatctcgaatcaagaagagcaagaag
cggaagttaaaaaaggcagaacggggggatagactcccacctcctgggcctccccaggca
ccccccagtgatacagactctgaagaggaggaggaagaggaggaagaggaagaagaagaa
gagatggcaacagtggtagggggtgaagccccagtccctgtgctgccaacaccccctgag
gctcctaggccccctgccacagtgcaccctgaaggagtccctcctgctgacagtgaaagc
aaggaggtgggcagcactgaaacaagccaagatggagatgccagctccagtgaaggcgag
atgcgggtcatggacgaggacatcatggtagaatcaggtgatgactcatgggatctgatc
acatgttactgtcgaaagccctttgcagggcggcccatgattgagtgcagcctgtgtggg
acgtggatccacctctcctgtgctaagattaagaagaccaacgtccccgacttcttttat
tgccagaaatgcaaggaactgaggccagaggcccggcggttaggggggcctcccaaatct
ggagagccctga

DBGET integrated database retrieval system