KEGG   Homo sapiens (human): 79153
Entry
79153             CDS       T01001                                 

Gene name
GDPD3, GDE7
Definition
(RefSeq) glycerophosphodiester phosphodiesterase domain containing 3
  KO
K22387  lysophospholipase D [EC:3.1.4.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    79153 (GDPD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.39  alkylglycerophosphoethanolamine phosphodiesterase
     79153 (GDPD3)
SSDB
Motif
Pfam: GDPD GDPD_2
Other DBs
NCBI-GeneID: 79153
NCBI-ProteinID: NP_077283
OMIM: 616318
HGNC: 28638
Ensembl: ENSG00000102886
Vega: OTTHUMG00000132106
Pharos: Q7L5L3(Tdark)
UniProt: Q7L5L3
Position
16p11.2
AA seq 318 aa
MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAME
NSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFS
PGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASE
KSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFP
FSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDY
PTALRHYLDNHGPAARTS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagccttttgctgtactatgccctccctgccctgggcagctatgccatgctctccatc
ttcttcctgcgccggcctcatctgctgcacacgcccagggctcccaccttccgcatccgc
ctgggggcccaccgaggaggatctggagagctgctggagaacaccatggaggccatggag
aactccatggcccagcgctcggacctcctggagctcgactgtcagctgacacgggacaga
gtggtggtggtgtcacatgatgagaacctgtgccgccagtcgggcctaaacagggatgtg
ggcagcctggacttcgaggacctgcccctctacaaggagaagctggaggtttacttctct
ccaggccactttgctcacgggtcagaccggcgcatggttcgtctggaggacctgttccag
aggtttccaaggacacccatgagcgtagagatcaaagggaagaacgaagagctcatccgt
gagatagcaggcttggtgagacgctatgaccgtaatgaaatcaccatctgggcctcggag
aagagctcggtcatgaagaaatgcaaggctgccaaccccgagatgcccctgtccttcaca
ataagccgaggattctgggtgctgctttcctactacctggggctgctgcccttcatccca
atccctgagaagttcttcttctgcttcctgcccaacatcatcaacaggacctatttccca
ttttcctgctcttgcctgaaccagttattggctgtggtttcgaaatggctgatcatgagg
aagagtctgatccgacacttggaggagcgaggggtgcaggtggtcttttggtgccttaat
gaagagtcggattttgaagcagccttcagcgtgggagccactggcgtcataacggattat
cccacagccctgcggcactacctggacaaccatggaccagctgcccggacctcctaa

DBGET integrated database retrieval system