KEGG   Homo sapiens (human): 7916
Entry
7916              CDS       T01001                                 

Gene name
PRRC2A, BAT2, D6S51, D6S51E, G2
Definition
(RefSeq) proline rich coiled-coil 2A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BAT2_N
Other DBs
NCBI-GeneID: 7916
NCBI-ProteinID: NP_004629
OMIM: 142580
HGNC: 13918
Ensembl: ENSG00000204469
Vega: OTTHUMG00000031168
Pharos: P48634(Tbio)
UniProt: P48634 A0A1U9X974
Position
6p21.33
AA seq 2157 aa
MSDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPA
NLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPPESQPLPASQTPASN
QPKRPPAAPENTPLVPSGVKSWAQASVTHGAHGDGGRASSLLSRFSREEFPTLQAAGDQD
KAAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGP
PQFPPYRGMMPPFMYPPYLPFPPPYGPQGPYRYPTPDGPSRFPRVAGPRGSGPPMRLVEP
VGRPSILKEDNLKEFDQLDQENDDGWAGAHEEVDYTEKLKFSDEEDGRDSDEEGAEGHRD
SQSASGEERPPEADGKKGNSPNSEPPTPKTAWAETSRPPETEPGPPAPKPPLPPPHRGPA
GNWGPPGDYPDRGGPPCKPPAPEDEDEAWRQRRKQSSSEISLAVERARRRREEEERRMQE
ERRAACAEKLKRLDEKFGAPDKRLKAEPAAPPAAPSTPAPPPAVPKELPAPPAPPPASAP
TPETEPEEPAQAPPAQSTPTPGVAAAPTLVSGGGSTSSTSSGSFEASPVEPQLPSKEGPE
PPEEVPPPTTPPVPKVEPKGDGIGPTRQPPSQGLGYPKYQKSLPPRFQRQQQEQLLKQQQ
QHQWQQHQQGSAPPTPVPPSPPQPVTLGAVPAPQAPPPPPKALYPGALGRPPPMPPMNFD
PRWMMIPPYVDPRLLQGRPPLDFYPPGVHPSGLVPRERSDSGGSSSEPFDRHAPAMLRER
GTPPVDPKLAWVGDVFTATPAEPRPLTSPLRQAADEDDKGMRSETPPVPPPPPYLASYPG
FPENGAPGPPISRFPLEEPGPRPLPWPPGSDEVAKIQTPPPKKEPPKEETAQLTGPEAGR
KPARGVGSGGQGPPPPRRESRTETRWGPRPGSSRRGIPPEEPGAPPRRAGPIKKPPPPTK
VEELPPKPLEQGDETPKPPKPDPLKITKGKLGGPKETPPNGNLSPAPRLRRDYSYERVGP
TSCRGRGRGEYFARGRGFRGTYGGRGRGARSREFRSYREFRGDDGRGGGTGGPNHPPAPR
GRTASETRSEGSEYEEIPKRRRQRGSETGSETHESDLAPSDKEAPTPKEGTLTQVPLAPP
PPGAPPSPAPARFTARGGRVFTPRGVPSRRGRGGGRPPPQVCPGWSPPAKSLAPKKPPTG
PLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGERPRRRRHGRAQQQDKPPRFRRL
KQERENAARGSEGKPSLTLPASAPGPEEALTTVTVAPAPRRAAAKSPDLSNQNSDQANEE
WETASESSDFTSERRGDKEAPPPVLLTPKAVGTPGGGGGGAVPGISAMSRGDLSQRAKDL
SKRSFSSQRPGMERQNRRPGPGGKAGSSGSSSGGGGGGPGGRTGPGRGDKRSWPSPKNRS
RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGSVTAPGGHPRHK
PGLPQAPQGPSPRPPTRYEPQRVNSGLSSDPHFEEPGPMVRGVGGTPRDSAGVSPFPPKR
RERPPRKPELLQEESLPPPHSSGFLGSKPEGPGPQAESRDTGTEALTPHIWNRLHTATSR
KSYRPSSMEPWMEPLSPFEDVAGTEMSQSDSGVDLSGDSQVSSGPCSQRSSPDGGLKGAA
EGPPKRPGGSSPLNAVPCEGPPGSEPPRRPPPAPHDGDRKELPREQPLPPGPIGTERSQR
TDRGTEPGPIRPSHRPGPPVQFGTSDKDSDLRLVVGDSLKAEKELTASVTEAIPVSRDWE
LLPSAAASAEPQSKNLDSGHCVPEPSSSGQRLYPEVFYGSAGPSSSQISGGAMDSQLHPN
SGGFRPGTPSLHPYRSQPLYLPPGPAPPSALLSGLALKGQFLDFSTMQATELGKLPAGGV
LYPPPSFLYSPAFCPSPLPDTSLLQVRQDLPSPSDFYSTPLQPGGQSGFLPSGAPAQQML
LPMVDSQLPVVNFGSLPPAPPPAPPPLSLLPVGPALQPPSLAVRPPPAPATRVLPSPARP
FPASLGRAELHPVELKPFQDYQKLSSNLGGPGSSRTPPTGRSFSGLNSRLKATPSTYSGV
FRTQRVDLYQQASPPDALRWIPKPWERTGPPPREGPSRRAEEPGSRGDKEPGLPPPR
NT seq 6474 nt   +upstreamnt  +downstreamnt
atgtccgatcgctcggggccgactgccaagggaaaggatggaaagaagtattcctcgctc
aacctgtttgatacgtataagggcaagtccttagagatccagaaacccgctgttgcccct
cgccatggcctgcagagtctcgggaaagttgccattgcccggcgtatgccacctccagcc
aaccttccaagcctgaaagccgagaacaaaggcaatgaccccaatgtctcactagtgcca
aaagacggaacaggatgggcaagcaaacaggagcagtccgaccccaagagttccgatgcc
tcaaccgctcagccgccggaatcgcagccactgccggcttcacagacgcctgcctccaac
cagccgaaacgacccccagcagcccccgagaacactcctttggttccaagcggggtaaag
tcctgggcacaagccagcgtcacccatggagcacatggagatggtggaagggcatcaagc
ctactgtcacgattctctcgagaggaatttccgaccctgcaggcggctggcgaccaggac
aaggctgccaaggaaagggagtctgccgaacagtcgtctgggcccggaccaagcctccgc
ccccaaaattctacaacttggagggacggaggtgggcgtggccctgatgagctggagggc
ccggactccaaacttcatcatggtcatgatccccggggtgggctacagccttcaggccca
ccccagttccctccctaccgcggaatgatgccgcctttcatgtatcccccatatctcccg
ttccctccgccctatggaccccaggggccttaccgataccccactcctgatgggcccagc
cgttttccccgtgtggcgggcccccgaggctcagggccaccaatgcgcttagtagagcct
gtgggtcgtccctctattctcaaagaggataatctcaaagagtttgatcagttggatcag
gagaatgatgatggttgggcaggggcccatgaagaggttgactacactgaaaagctcaag
ttcagcgatgaggaagatgggcgagactctgatgaggagggtgctgagggccacagggat
tcccaatcagcttctggtgaggaacggccccctgaagcagatggcaaaaagggcaactcc
cccaacagcgaaccgcccactcctaagacggcctgggcagaaacctctcggcctccagag
acagagccgggacctcctgccccaaagcctcccctacccccacctcaccggggccccgcc
gggaactggggcccccctggggactacccagatcgtgggggtcctccctgcaagccccca
gcacctgaagatgaggatgaggcatggcggcagcgacgaaagcagtcgtcatctgagatt
tccctggcagtggagcgggcccggcgacggcgagaagaagaggagcggcgcatgcaagaa
gagcgccgggcagcctgtgctgagaagctcaagcgactcgatgaaaagtttggggcacct
gacaagcggctcaaagcagagcctgctgccccacctgctgccccttctaccccagctcca
ccacctgcagtccctaaagaactccctgcacctccagctccacctccagcatcagcccca
acaccagagacagaacctgaagagccagcacaggcccctcctgcccaatctactcctact
ccaggtgtggctgcggctcccactctggtgagtggtggtggcagtaccagtagcaccagc
agtggcagcttcgaagccagcccagtggaaccacaactgccctcaaaagagggtcctgaa
ccaccagaagaggttcctcctcctaccacacccccagttccaaaggtggaacccaagggt
gatgggattggtcccacccgccagccccctagtcagggcttgggctaccccaaatatcag
aagtcgttgcctcctcgtttccagcggcagcagcaggagcagctcctgaagcagcagcag
cagcaccagtggcagcagcatcaacagggctctgcccctcctaccccagtgcccccatca
ccaccacagcctgtgaccctgggggctgtgccagctccacaggctccacccccgcccccc
aaggccctgtacccaggtgctctgggccggcccccacccatgcccccaatgaactttgat
ccccgatggatgatgattcctccttatgtggacccccggctcctccagggtcgtccccct
ctagacttctaccctcctggtgtgcatccctctggcctagttccccgagagcgttcagac
agtgggggctcaagctcagagccatttgaccgtcatgcacctgctatgttacgggaacgg
ggcactccaccggtggatccaaagttggcctgggtaggagatgtcttcaccgccacaccc
gctgaaccccgcccacttacctcacctctgcgccaggctgcggatgaggatgacaagggg
atgaggagcgagactcctccagtacctcccccaccaccctatctggccagttatccaggc
tttcctgagaatggagcccctgggcccccaatctctcgctttcctctggaggaaccaggg
ccccgtccactcccctggcccccaggcagtgatgaagtggccaagatacaaactccacca
cccaagaaggagccccctaaggaggagactgcacagctgacggggccagaagcaggccga
aagcctgcccgcggagtcgggagtggaggccagggccccccaccaccacgcagagagagt
cgcacagagacccgctggggccctcgtccagggagcagtcgtcgtggaatccctccagag
gagccaggggccccaccccgccgggctgggcctataaagaaacctccaccacctacaaaa
gtagaagagctgcctcccaagcccctcgaacagggggatgaaacccccaaacccccaaag
ccagacccactcaagataaccaaggggaagctagggggccccaaggagaccccacccaat
ggaaatctttcccctgccccaaggcttcggagggactattcgtatgaaagagtgggtcct
acctcttgccggggtcggggccgaggcgagtattttgccagagggaggggttttcggggg
acctatgggggacgagggcggggagcccgaagccgggaattccgcagttaccgagagttt
cgaggagatgatgggcgtggaggtgggacagggggaccaaaccaccctcctgctccccga
ggccgcactgccagcgagacacggagcgagggttcagagtatgaggaaatccccaagcgg
cgccggcagcggggctcagaaacaggcagcgagacccatgagagtgatctggctccttca
gacaaggaggctcccacacccaaggagggaacactcacccaggtccctctcgctccccca
ccaccaggagccccaccttcaccagccccagcccgcttcactgcccggggtgggcgagtc
ttcactcccagaggggtgccatctcgccggggccgaggaggagggaggccccctcctcaa
gtttgcccaggctggagccctccagccaagtctctggctcccaagaaacctcccacaggc
cctttgccaccaagtaaggagcctttgaaagagaagttgatcccagggcctctgtcccct
gtggcgcgcggaggcagcaatggaggtagcaatgtgggcatggaagatggggagcgaccc
cgaaggaggcgacatgggagggctcagcagcaggataaaccgcctcgtttccggaggctg
aagcaggaacgggagaatgccgcaagggggtctgagggcaagccctccctaacccttcca
gcctccgctcctggacctgaggaggccctcacaacagtcacagtggccccagcacctcgc
cgggcagctgccaagtctcctgatctgtcaaaccagaactcagaccaagccaatgaggaa
tgggagactgcatcagagagcagtgacttcaccagtgagcgccgaggggacaaagaggca
cccccaccagtactgctgacacccaaggctgtgggaactcctgggggaggtggaggtgga
gccgtaccaggtatttcagccatgtcccgcggagatctgagccagagagccaaggatttg
agtaaacggagcttctcaagtcagcggccaggcatggaacggcagaatcggcgccctggc
ccagggggcaaggctggcagcagtggcagcagcagtggaggaggcggtgggggtcctgga
ggaaggaccgggccaggacgaggcgacaagaggagctggccctctcccaagaaccgaagt
cgtcctccagaggagcgtcccccggggcttcccctgcctcccccacctcccagcagttct
gctgtcttccgcctggaccaagttatccacagcaaccctgctggcatccaacaggctctg
gcccagcttagtagccgtcaagggagtgtaactgcaccagggggtcatccaaggcacaag
cctgggcttccccaagcccctcagggcccctctcctaggcccccaacccgatacgagccc
cagagggtcaacagcggcctcagttctgacccccactttgaggagccggggccaatggtg
agaggggtgggtgggactcctcgggactctgccggggttagtccctttccccctaaacgt
cgggagcggcctcccagaaaaccagagctgctacaggaggaatctttgccacctcctcat
agctctggattcttgggctctaagcctgagggcccaggccctcaggcagagtccagagat
acaggcacagaggccctgacccctcacatctggaaccgtttacatactgccactagccga
aagagttaccggcccagctccatggagccttggatggagcccctgagtccttttgaggat
gtggctggcacagaaatgagtcagtctgacagtggggtggacctgagtggggattctcag
gtgtcatcaggtccctgcagccagcgaagttcccctgatggaggactcaagggggcagca
gagggaccccccaagaggcctggaggctcctcacccctgaatgctgttccttgtgagggt
ccacctggctctgaacctcctaggagaccaccacctgccccccacgatggggacagaaag
gagctgccccgggagcagcctctgccccctggccccattggcacagaacgatcacagcgt
acagaccgaggcacagagcctggccccattcggccatcccatcgacctggtcccccagtc
cagtttggcactagtgacaaggactcagacttacgcctagtggtaggagacagcttgaaa
gcagagaaggagctaacagcatcagtcactgaggccattcctgtatcacgagactgggag
ctgcttcccagtgctgctgcctctgctgagccacaatccaagaacctggattctgggcac
tgtgtcccggagcccagctcctcaggccagcgcctgtatcctgaggttttctatggcagt
gctgggccttccagttctcagatctctgggggagccatggactctcaattacatccaaac
agtggaggcttccgccctgggacaccctcactgcacccttacagatcacagcccctatac
ctaccccccggcccagcccctccctcagcactgctctctgggttagctctcaagggccag
tttctggatttctccacaatgcaagctacagagctggggaagttgccggctggaggagtt
ctctaccctccaccttccttcctctactctccggctttctgccccagtcctttgcctgac
acatcgttgcttcaggtacgccaggatctgccatccccttcggatttttattctactcct
ctgcagcctggtggccaaagtggctttctcccttcaggggctcctgcccagcagatgctt
ctacccatggtagactcacagctgcctgtggtgaactttggctccctgccgccagcacca
cctcctgccccacctcccctttctctgttacctgtgggccctgctctgcagccccccagc
ctggctgtgcggcccccacctgctcctgctactcgggtgctgccttcacctgccaggccc
ttccccgctagcttggggcgagcagagctgcatccagtggaactaaagccgttccaggat
tatcaaaaactgagcagcaaccttgggggacctggatcatcacggactcccccaactgga
aggtccttctctggcctcaattcccgtctcaaggccacgccttccacctacagtggagtc
ttccgcacccagcgcgtcgacctttaccagcaggcctccccaccagatgccctgcgctgg
atacctaagccttgggagcggacagggccgccacctcgagaagggccctcccgacgggca
gaggagcctgggtcccgaggggacaaggagcctgggttgcccccaccccgctga

DBGET integrated database retrieval system