KEGG   Homo sapiens (human): 79169
Entry
79169             CDS       T01001                                 

Gene name
C1orf35, MMTAG2
Definition
(RefSeq) chromosome 1 open reading frame 35
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MMtag DUF3987 SRP-alpha_N DUF3665 Jak1_Phl SAPS U79_P34
Other DBs
NCBI-GeneID: 79169
NCBI-ProteinID: NP_077295
HGNC: 19032
Ensembl: ENSG00000143793
Vega: OTTHUMG00000037793
Pharos: Q9BU76(Tdark)
UniProt: Q9BU76
Position
1q42.13
AA seq 263 aa
MFGSSRGGVRGGQDQFNWEDVKTDKQRENYLGNSLMAPVGRWQKGRDLTWYAKGRAPCAG
PSREEELAAVREAEREALLAALGYKNVKKQPTGLSKEDFAEVCKREGGDPEEKGVDRLLG
LGSASGSVGRVAMSREDKEAAKLGLSVFTHHRVESGGPGTSAASARRKPRAEDQTESSCE
SHRKSKKEKKKKKKRKHKKEKKKKDKEHRRPAEATSSPTSPERPRHHHHDSDSNSPCCKR
RKRGHSGDRRSPSRRWHDRGSEA
NT seq 792 nt   +upstreamnt  +downstreamnt
atgttcggctccagtcgtggaggcgtgcgcggcgggcaggaccagttcaactgggaggac
gtgaagactgacaagcagcgggagaactacctgggcaactcgctgatggcgccggtaggc
cgctggcagaagggccgcgacctcacctggtacgccaagggccgggcgccatgcgcgggc
ccgagccgcgaggaggaactggcagccgtgcgggaggcggagcgcgaggcgctgctggcc
gcccttggctacaagaacgtgaagaagcagcccacgggcctgagcaaggaggacttcgcg
gaggtctgcaagcgggaaggaggcgaccccgaggagaagggcgtggaccggctgctgggg
ctggggagcgcaagtggctccgtgggccgcgtggcgatgtcccgagaggacaaggaggcc
gccaaactggggctgtctgtgttcacgcatcaccgcgtagagagcggcgggcccgggacc
tcggcagcctcggccaggaggaagccgcgggcggaggatcagacggaaagcagttgtgag
agccacaggaaaagcaagaaggagaagaagaaaaagaaaaagaggaaacacaagaaagag
aagaagaagaaagacaaagagcacaggcggccagctgaggccacctcctctcccacatct
cctgagaggcccaggcaccaccaccatgactccgactccaactccccctgctgtaagagg
aggaagcggggacacagtggggacaggaggagcccgtctcgcaggtggcatgacagaggc
tctgaggcctga

DBGET integrated database retrieval system