KEGG   Homo sapiens (human): 79170Help
Entry
79170             CDS       T01001                                 

Gene name
PRR15L, ATAD4
Definition
(RefSeq) proline rich 15 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ATAD4
Motif
Other DBs
NCBI-GeneID: 79170
NCBI-ProteinID: NP_077296
HGNC: 28149
Ensembl: ENSG00000167183
Vega: OTTHUMG00000178297
Pharos: Q9BU68(Tdark)
UniProt: Q9BU68 A0A140VJT1
Position
17q21.32
AA seq 103 aa AA seqDB search
MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVD
KSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgaaattggttggtggaagctgactttcctccggaaaaagaaatccactccc
aaagtgctgtatgagatccctgacacctatgcccaaacagagggagatgcagaacccccg
aggcctgacgctggaggccccaacagcgactttaacacccgcctggagaagattgtggac
aagagcacaaagggcaagcacgtcaaggtctccaactcaggacgcttcaaggagaagaag
aaagtgagagccacgctggcagagaaccctaacctctttgatgatcacgaggaaggacgg
tcatcaaagtga

DBGET integrated database retrieval system