KEGG   Homo sapiens (human): 79173
Entry
79173             CDS       T01001                                 
Symbol
BRME1, C19orf57, MEIOK21
Name
(RefSeq) break repair meiotic recombinase recruitment factor 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Brme1
Other DBs
NCBI-GeneID: 79173
NCBI-ProteinID: NP_001332773
OMIM: 619276
HGNC: 28153
Ensembl: ENSG00000132016
Pharos: Q0VDD7(Tdark)
UniProt: Q0VDD7
Position
19:complement(13882348..13906117)
AA seq 637 aa
MTKRKKLRTSGEGLCPPKPLKNPRLGDFYGDPQSSMLGCLHHPEEPEGKLGPVPSTQQHG
EEPGKAVSSSPDEETGSPCRLLRQPEKEPAPLPPSQNSFGRFVPQFAKSRKTVTRKEEMK
DEDRGSGAFSLETIAESSAQSPGCQLLVETLGVPLQEATELGDPTQADSARPEQSSQSPV
QAVPGSGDSQPDDPPDRGTGLSASQRASQDHLSEQGADDSKPETDRVPGDGGQKEHLPSI
DSEGEKPDRGAPQEGGAQRTAGAGLPGGPQEEGDGVPCTPASAPTSGPAPGLGPASWCLE
PGSVAQGSPDPQQTPSRMGREGEGTHSSLGCSSLGMVVIADLSTDPTELEERALEVAGPD
GQASAISPASPRRKAADGGHRRALPGCTSLTGETTGESGEAGQDGKPPGDVLVGPTASLA
LAPGSGESMMGAGDSGHASPDTGPCVNQKQEPGPAQEEAELGGQNLERDLEGFRVSPQAS
VVLEHREIADDPLQEPGAQQGIPDTTSELAGQRDHLPHSADQGTWADSLAVELDFLLDSQ
IQDALDASDFEAPPEQLFPSGNKPGPCWPGPSSHANGDPVAVAKAQPSRLIMGTHRDLEA
FKRLNYRKTKLGGKAPLPYPSKGPGNIPRGDPPWREL
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgactaagaggaagaagctgcggacctcaggagagggactctgtcctccaaaaccccta
aagaacccaaggctaggagacttctatggggacccccagagttccatgttgggctgttta
catcaccctgaggagccagagggcaaattgggacctgttccctctacacagcagcacggg
gaggaaccaggaaaggccgtctccagctcccctgatgaggaaacaggatctccctgccgg
ctcctccgtcaaccagaaaaggagccagctccccttcctccttcccagaactcattcggg
aggtttgttccccagtttgcaaaatccaggaagacagtgacaagaaaagaagagatgaag
gatgaggaccgtgggagtggggcctttagcctggaaacaatcgcagagtccagcgcccag
agtccaggatgccagctgctagtggagaccctgggggtccccctccaggaggccacggag
ctgggggacccaacgcaggcagacagtgcccgccctgagcagagcagccagagccctgtg
caggcggtgcccggcagtggggattctcagcctgatgaccctccagacagggggacgggg
ttgtccgcctcacagagggccagccaagaccacctgtcagaacaaggggccgatgacagc
aagcctgagacagacagggttccaggtgacggtggccaaaaggaacacctaccaagcatt
gattctgaaggggagaagccagacagaggagccccccaggagggaggggcccaaaggaca
gcaggggctggcctgcctggagggccccaggaggagggagacggtgtcccctgtacccca
gcatcagctcctacctcaggccctgctccaggactgggccctgcctcttggtgcctggaa
cccgggtctgtggcccagggctcccctgacccccagcagacccccagcaggatgggtagg
gaaggggaagggactcatagcagcctgggatgctcctccctcgggatggttgtcatcgca
gacctgagcacagaccccactgagctggaagagagggctctggaggtggctgggcccgat
gggcaggccagtgccatatcacctgcctctcccaggaggaaggccgctgatggaggccac
aggagggccttgccaggctgcacctcgctcactggggaaaccacaggagaaagtggggag
gcagggcaggatggcaagccccccggcgatgtcctagtgggccctacagcctccctggct
ctggcacctgggagcggagagtccatgatgggtgctggagattccggtcatgcatccccg
gacacaggtccatgtgtcaatcagaagcaggagccaggtcctgctcaagaggaagccgag
ttaggtggccagaacctcgaacgagacctcgaggggttccgtgtgtccccgcaagcctct
gttgtgctggaacacagagaaatagcagacgaccctctccaggagcccggggctcagcag
ggcattccagacaccacctcagagctggcagggcagcgagaccacctgcctcattctgca
gaccagggcacctgggcagactctttagctgtggaactcgacttcctgctggacagccag
atacaggatgccctggacgcctctgacttcgaagccccacctgagcagctctttccttcg
gggaacaagccgggcccttgctggccgggccccagctcacatgccaatggagaccctgtt
gcagtggccaaggcccagccgagccggctgatcatgggcacccaccgggacctggaagct
ttcaagcgccttaactaccggaagacaaagctgggaggcaaagcccccctgccttaccct
tccaaggggcctgggaatatccctcgaggggacccaccctggagggagttgtag

DBGET integrated database retrieval system