KEGG   Homo sapiens (human): 79187Help
Entry
79187             CDS       T01001                                 

Gene name
FSD1, GLFND, MIR1
Definition
(RefSeq) fibronectin type III and SPRY domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY fn3 DUF4945
Motif
Other DBs
NCBI-GeneID: 79187
NCBI-ProteinID: NP_077309
OMIM: 609828
HGNC: 13745
Ensembl: ENSG00000105255
Vega: OTTHUMG00000181881
Pharos: Q9BTV5(Tbio)
UniProt: Q9BTV5
Position
19p13.3
AA seq 496 aa AA seqDB search
MEEQREALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQAMDSEDFPQAAKQI
KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVADN
CVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
YMNFRVKACNKAVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPD
CLGVHCDFHQGLLSFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC
LQKRGSATSSSNTSLT
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacagagggaggccctgaggaagatcatcaaaacactggctgtgaagaatgaa
gaaattcagagctttatctactccctgaaacagatgctgctgaacgtggaggcgaactcg
gcgaaggtgcaggaggacctcgaagcagagttccagtccctcttctccctcctggaggag
ctgaaagaaggcatgcttatgaagataaaacaggaccgtgccagccgtacctacgagctg
cagaaccagctggctgcctgcacgcgggccctggagagctccgaggagcttctggagaca
gccaaccagactctgcaggccatggacagcgaggactttcctcaggctgccaagcaaatc
aaagatggagtgaccatggcccctgccttccggctatcattgaaagcgaaggtcagtgac
aacatgagtcacctcatggtggacttcgcgcaagagcggcagatgctacaggcactcaag
ttcctgcctgtgcccagcgcacccgtgatcgacctggctgagtccctggtggcagataac
tgtgtgaccctggtgtggcgcatgccggatgaggacagcaagattgaccactacgtgctg
gagtaccggcggaccaacttcgagggcccgccccgcctcaaggaggaccagccctggatg
gtcatcgagggcatccggcagacagagtacaccctgacaggtctcaagtttgacatgaaa
tacatgaacttccgtgtgaaggcctgtaacaaggcagttgcaggagagttctctgagccg
gtgactctggagacaccagcgttcatgttccgcctggatgcgtccacatcccaccagaac
ctgcgggtggatgatctctccgtggagtgggacgctatgggcgggaaggtgcaggatatc
aaggctcgcgagaaagatggcaaggggcggacggcgtctcccatcaactccccagccaga
ggtactccatctcccaagaggatgccctcaggtcgtgggggacgggaccgcttcaccgct
gagtcctacacagttctgggggacacgctgatcgacggcggggagcattactgggaggtg
cgctacgagccggacagcaaggcgttcggcgtgggcgtggcctaccgcagcctgggccgc
ttcgagcaactgggcaagacggccgcctcctggtgcctgcacgtcaacaattggctgcag
gtcagcttcacggccaagcacgccaacaaggtcaaggtgctggacgcccccgtgcccgac
tgcctgggtgtgcactgtgacttccaccaaggcctcctgtccttctacaatgcccgcacc
aaacaagtgctgcacactttcaagaccaggttcacacagccgctgctgcctgctttcacg
gtatggtgtggcagcttccaggtgacgacaggcctgcaggtccccagtgctgtgcgctgc
ctgcaaaagcgaggcagtgctaccagcagctccaacaccagcctcacctag

DBGET integrated database retrieval system