KEGG   Homo sapiens (human): 7919
Entry
7919              CDS       T01001                                 
Symbol
DDX39B, BAT1, D6S81E, UAP56
Name
(RefSeq) DExD-box helicase 39B
  KO
K12812  ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    7919 (DDX39B)
  09122 Translation
   03013 Nucleocytoplasmic transport
    7919 (DDX39B)
   03015 mRNA surveillance pathway
    7919 (DDX39B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7919 (DDX39B)
   03041 Spliceosome [BR:hsa03041]
    7919 (DDX39B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     7919 (DDX39B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     7919 (DDX39B)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    7919 (DDX39B)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    7919 (DDX39B)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1
Other DBs
NCBI-GeneID: 7919
NCBI-ProteinID: NP_004631
OMIM: 142560
HGNC: 13917
Ensembl: ENSG00000198563
Vega: OTTHUMG00000031165
Pharos: Q13838(Tbio)
UniProt: Q13838 A0A024RCM3
Structure
Position
6:complement(31530226..31542003)
AA seq 428 aa
MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAI
VDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMC
HTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALA
RNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCR
KFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRC
IALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAF
NYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI
SSYIEQTR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggcagagaacgatgtggacaatgagctcttggactatgaagatgatgaggtggagaca
gcagctgggggagatggggctgaggcccctgccaagaaggatgtcaagggctcctatgtc
tccatccacagctctggctttcgtgacttcctgctcaagccagagttgctccgggccatt
gtcgactgtggctttgagcatccgtcagaagtccagcatgagtgcatccctcaggccatt
ctgggaatggatgtcctgtgccaggccaagtcgggcatgggaaagacagcagtgtttgtc
ttggccacactgcaacagctggagccagttactgggcaggtgtctgtactggtgatgtgt
cacactcgggagttggcttttcagatcagcaaggaatatgagcgcttctctaaatacatg
cccaatgtcaaggttgctgttttttttggtggtctgtctatcaagaaggatgaagaggtg
ctgaagaagaactgcccgcatatcgtcgtggggactccaggccgtatcctagccctggct
cgaaataagagcctcaacctcaaacacattaaacactttattttggatgaatgtgataag
atgcttgaacagctcgacatgcgtcgggatgtccaggaaatttttcgcatgaccccccac
gagaagcaggtcatgatgttcagtgctaccttgagcaaagagatccgtccagtctgccgc
aagttcatgcaagatccaatggagatcttcgtggatgatgagacgaagttgacgctgcat
gggttgcagcagtactacgtgaaactgaaggacaacgagaagaaccggaagctctttgac
cttctggatgtccttgagttcaaccaggtggtgatctttgtgaagtctgtgcagcggtgc
attgccttggcccagctactagtggagcagaacttcccagccattgccatccaccgtggg
atgccccaggaggagaggctttctcggtatcagcagtttaaagattttcaacgacgaatt
cttgtggctaccaacctatttggccgaggcatggacatcgagcgggtgaacattgctttt
aattatgacatgcctgaggattctgacacctacctgcatcgggtggccagagcaggccgg
tttggcaccaagggcttggctatcacatttgtgtccgatgagaatgatgccaagatcctc
aatgatgtgcaggatcgctttgaggtcaatattagtgagctgcctgatgagatagacatc
tcctcctacattgaacagacacggtag

DBGET integrated database retrieval system