KEGG   Homo sapiens (human): 79190Help
Entry
79190             CDS       T01001                                 

Gene name
IRX6, IRX-3, IRX7, IRXB3
Definition
(RefSeq) iroquois homeobox 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox_KN Homeodomain DUF4684 MRP-S32
Motif
Other DBs
NCBI-GeneID: 79190
NCBI-ProteinID: NP_077311
OMIM: 606196
HGNC: 14675
Ensembl: ENSG00000159387
Vega: OTTHUMG00000172239
Pharos: P78412(Tbio)
UniProt: P78412
Position
16q12.2
AA seq 446 aa AA seqDB search
MSFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAPYDSRLLGSA
RPELGAALGIYGAPYAAAAAAQSYPGYLPYSPEPPSLYGALNPQYEFKEAAGSFTSSLAQ
PGAYYPYERTLGQYQYERYGAVELSGAGRRKNATRETTSTLKAWLNEHRKNPYPTKGEKI
MLAIITKMTLTQVSTWFANARRRLKKENKMTWAPKNKGGEERKAEGGEEDSLGCLTADTK
EVTASQEARGLRLSDLEDLEEEEEEEEEAEDEEVVATAGDRLTEFRKGAQSLPGPCAAAR
EGRLERRECGLAAPRFSFNDPSGSEEADFLSAETGSPRLTMHYPCLEKPRIWSLAHTATA
SAVEGAPPARPRPRSPECRMIPGQPPASARRLSVPRDSACDESSCIPKAFGNPKFALQGL
PLNCAPCPRRSEPVVQCQYPSGAEAG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcccacactttggacacccgtaccgcggcgcttcccagtttctggcgtcggca
agttccagcaccacatgctgcgaatctacccaacgctctgtctcagatgtggcatcaggc
tccaccccagcgcccgctctctgctgcgcaccctacgatagtcgactgctgggcagtgcg
cgaccggagctgggcgccgccttgggcatctatggagcaccctatgcggccgctgcagct
gcccagagctaccctggctacctgccctatagcccagagcccccctcactgtatggggca
ctgaatccacagtatgaatttaaggaggctgcagggagttttacatccagcctggcacaa
ccaggagcctattatccctatgagcggactctggggcagtaccaatatgaacggtatggc
gcagtggaattgagtggcgccggtcgccgaaagaacgcgacccgggagaccaccagtaca
ctcaaggcctggctcaacgagcaccgcaaaaacccctaccccactaagggtgagaagatc
atgctggccatcatcaccaagatgaccctcacccaggtgtccacctggttcgccaacgca
cgccggcgcctcaagaaagagaacaaaatgacatgggcgcccaagaacaaaggtggggag
gagaggaaggcagagggaggagaggaggactcactaggctgcctaactgctgacaccaaa
gaagttactgctagccaggaggcccgggggctccggctgagtgacctggaagacctggag
gaagaggaggaggaggaggaggaagctgaagacgaggaggtagtggccacagctggggac
aggctgacggagttccgaaagggcgcgcagtcactgcctgggccgtgcgctgcagctcga
gagggccgattggagcgcagggagtgcggcctggctgcgccccgcttctccttcaatgac
ccttccggatcggaagaagctgacttcctctcggcggagacaggcagccctaggttgacc
atgcactacccatgcttggagaaaccgcgcatctggtctctggcgcacaccgcgacagcc
agcgctgttgaaggtgcacccccagcccggcctaggccacgaagtcctgagtgccgtatg
attcctggacagcctcctgcctctgcccggcgactctcagtccccagagactccgcgtgc
gacgagtcttcctgcatacccaaagcctttggaaaccccaagtttgccctgcagggacta
ccgctgaactgtgcgccgtgcccgcggaggagcgagcctgtagtgcagtgccagtacccg
tctggagcagaagcaggttag

DBGET integrated database retrieval system