KEGG   Homo sapiens (human): 7920
Entry
7920              CDS       T01001                                 

Gene name
ABHD16A, BAT5, D6S82E, NG26, PP199, hBAT5
Definition
(RefSeq) abhydrolase domain containing 16A, phospholipase
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Peptidase_S9
Other DBs
NCBI-GeneID: 7920
NCBI-ProteinID: NP_066983
OMIM: 142620
HGNC: 13921
Ensembl: ENSG00000204427
Vega: OTTHUMG00000031177
Pharos: O95870(Tchem)
UniProt: O95870 A0A1U9X777
Position
6p21.33
AA seq 558 aa
MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSI
LALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWT
NPQYRQFITILEATHRNQSSENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGV
ALLRPEPLHRGTADTLLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQG
QARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFT
ATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQG
PVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQL
EEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFE
ATHCTPLPAQNFQMPWHL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggcgaagctgctgagctgcgtcctaggcccccggctctacaaaatctaccgggagagg
gactctgaaagggccccggccagcgtccctgagacgccaacggcagtcactgccccccat
tccagctcctgggatacgtactatcagccccgtgccctggagaaacatgctgacagcatc
ctggcactggcttcagtattctggtccatctcttattactcctctcccttcgccttcttc
tacttgtacaggaaaggttacttgagtttgtccaaagtggtgccgttttctcactatgct
gggacattgctgctacttctggcaggtgtggcctgcctccgaggcattggccgctggacc
aacccccagtaccggcagttcatcaccatcttggaagcaacacatcggaaccagtcttca
gaaaacaagaggcagcttgccaactacaactttgacttccggagctggccagtcgacttc
cactgggaagaacccagcagccggaaggagtctcgagggggcccttcccgccggggtgtg
gccctgcttcgcccagagcccctgcaccgggggacagcagacaccctcctcaaccgggtt
aagaagctgccttgtcagatcaccagctacctggtggcgcacaccctagggcgccggatg
ctgtatccaggctctgtgtacctgctgcagaaggccctcatgcctgtgctgctgcagggc
caggcccgactggtggaagagtgtaatgggcgccgggcaaagctgctggcctgtgatggc
aatgagattgacaccatgtttgtggaccggcgggggacagctgagccccagggacagaag
ctggtgatctgctgtgaggggaatgctgggttttatgaggtgggctgcgtctccacgccc
ctggaagctggatattcagtcctgggctggaatcatccaggctttgctggaagcacgggg
gtgccattcccgcagaatgaggctaatgccatggatgtggtggtccagtttgccatccac
cgcctaggcttccagccccaggacatcatcatctacgcctggtccatcggcggcttcact
gccacgtgggcagccatgtcctacccagatgttagtgccatgatcctggatgcctccttt
gatgacctggtgcccttggccttgaaggtcatgccagacagctggaggggcctggtgacc
aggaccgtgaggcagcatctcaatctaaacaacgcggagcagctgtgcagataccagggt
cctgtactgctgatccggagaaccaaggatgagatcatcaccaccacggttcctgaggac
atcatgtccaaccgaggcaatgacctcctgctgaagctcctgcagcatcggtatccccgg
gtgatggcagaggagggtcttcgagtggtgaggcagtggttggaggcctcctcacagctg
gaggaagcctcaatttatagccgatgggaggtggaagaggactggtgtctgtctgtcctc
cgctcctaccaggcagaacacgggcccgacttcccctggagcgtgggggaggacatgagt
gcagatggacggcggcagctggctttgtttctggctcggaagcatctgcacaactttgag
gccactcactgcaccccactcccagcccagaacttccagatgccctggcacctctag

DBGET integrated database retrieval system