KEGG   Homo sapiens (human): 7920
Entry
7920              CDS       T01001                                 
Symbol
ABHD16A, BAT5, D6S82E, NG26, PP199, SPG86, hBAT5
Name
(RefSeq) abhydrolase domain containing 16A, phospholipase
  KO
K25824  abhydrolase domain-containing protein 16A [EC:3.1.1.23 3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00098  Acylglycerol degradation
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    7920 (ABHD16A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7920 (ABHD16A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     7920 (ABHD16A)
   3.1.-
    3.1.-.-
     7920 (ABHD16A)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   7920 (ABHD16A)
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Peptidase_S9
Other DBs
NCBI-GeneID: 7920
NCBI-ProteinID: NP_066983
OMIM: 142620
HGNC: 13921
Ensembl: ENSG00000204427
Pharos: O95870(Tchem)
UniProt: O95870 A0A1U9X777
Position
6:complement(31686955..31703324)
AA seq 558 aa
MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSI
LALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWT
NPQYRQFITILEATHRNQSSENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGV
ALLRPEPLHRGTADTLLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQG
QARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFT
ATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQG
PVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQL
EEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFE
ATHCTPLPAQNFQMPWHL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggcgaagctgctgagctgcgtcctaggcccccggctctacaaaatctaccgggagagg
gactctgaaagggccccggccagcgtccctgagacgccaacggcagtcactgccccccat
tccagctcctgggatacgtactatcagccccgtgccctggagaaacatgctgacagcatc
ctggcactggcttcagtattctggtccatctcttattactcctctcccttcgccttcttc
tacttgtacaggaaaggttacttgagtttgtccaaagtggtgccgttttctcactatgct
gggacattgctgctacttctggcaggtgtggcctgcctccgaggcattggccgctggacc
aacccccagtaccggcagttcatcaccatcttggaagcaacacatcggaaccagtcttca
gaaaacaagaggcagcttgccaactacaactttgacttccggagctggccagtcgacttc
cactgggaagaacccagcagccggaaggagtctcgagggggcccttcccgccggggtgtg
gccctgcttcgcccagagcccctgcaccgggggacagcagacaccctcctcaaccgggtt
aagaagctgccttgtcagatcaccagctacctggtggcgcacaccctagggcgccggatg
ctgtatccaggctctgtgtacctgctgcagaaggccctcatgcctgtgctgctgcagggc
caggcccgactggtggaagagtgtaatgggcgccgggcaaagctgctggcctgtgatggc
aatgagattgacaccatgtttgtggaccggcgggggacagctgagccccagggacagaag
ctggtgatctgctgtgaggggaatgctgggttttatgaggtgggctgcgtctccacgccc
ctggaagctggatattcagtcctgggctggaatcatccaggctttgctggaagcacgggg
gtgccattcccgcagaatgaggctaatgccatggatgtggtggtccagtttgccatccac
cgcctaggcttccagccccaggacatcatcatctacgcctggtccatcggcggcttcact
gccacgtgggcagccatgtcctacccagatgttagtgccatgatcctggatgcctccttt
gatgacctggtgcccttggccttgaaggtcatgccagacagctggaggggcctggtgacc
aggaccgtgaggcagcatctcaatctaaacaacgcggagcagctgtgcagataccagggt
cctgtactgctgatccggagaaccaaggatgagatcatcaccaccacggttcctgaggac
atcatgtccaaccgaggcaatgacctcctgctgaagctcctgcagcatcggtatccccgg
gtgatggcagaggagggtcttcgagtggtgaggcagtggttggaggcctcctcacagctg
gaggaagcctcaatttatagccgatgggaggtggaagaggactggtgtctgtctgtcctc
cgctcctaccaggcagaacacgggcccgacttcccctggagcgtgggggaggacatgagt
gcagatggacggcggcagctggctttgtttctggctcggaagcatctgcacaactttgag
gccactcactgcaccccactcccagcccagaacttccagatgccctggcacctctag

DBGET integrated database retrieval system