KEGG   Homo sapiens (human): 7922Help
Entry
7922              CDS       T01001                                 

Gene name
SLC39A7, D6S115E, D6S2244E, H2-KE4, HKE4, KE4, RING5, ZIP7
Definition
(RefSeq) solute carrier family 39 member 7
  KO
K14713  solute carrier family 39 (zinc transporter), member 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7922 (SLC39A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC39: Metal ion transporter
   7922 (SLC39A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zip
Motif
Other DBs
NCBI-GeneID: 7922
NCBI-ProteinID: NP_001070984
OMIM: 601416
HGNC: 4927
Ensembl: ENSG00000112473
Vega: OTTHUMG00000031238
Pharos: Q92504(Tbio)
UniProt: Q92504 A0A024RCX7
Position
6p21.32
AA seq 469 aa AA seqDB search
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH
AHGHGHTHESIWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGES
GAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGL
LGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHV
KGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP
VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEV
PHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccagaggcctgggggccccccactgggtggccgtgggactgctgacctgggcgacc
ttggggcttctggtggctggactcgggggtcatgacgacctgcacgacgatctgcaagag
gacttccatggccacagccacaggcactcacatgaagatttccaccatggccacagccat
gcccatggccatggccacactcacgagagcatctggcatggacatacccacgatcacgac
catggacattcacatgaggatttacaccatggccatagccatggctactcccatgagagc
ctctaccacagaggacatggacatgaccatgagcatagccatggaggctatggggagtct
ggggctccaggcatcaagcaggacctggatgctgtcactctctgggcttatgcactgggg
gccacagtgctgatctcagcagctccattttttgtcctcttccttatccccgtggagtcg
aactctccccggcatcgctctctacttcagatcttgctcagttttgcttccggtgggctc
ctgggagatgctttcctgcacctcattcctcatgctcttgaacctcattctcaccacact
ctggagcaacccggacatggacactcccacagtggccagggccccattctgtctgtggga
ctgtgggttctcagtggaattgttgcctttcttgtcgtggagaaatttgtgagacatgtg
aaaggaggacatggtcacagtcatggacatggacacgctcacagtcatacacgtggaagt
catggacatggaagacaagagcgttctaccaaggagaagcagagctcagaggaagaagaa
aaggaaacaagaggggttcagaagaggcgaggagggagcacagtacccaaagatgggcca
gtgagacctcagaacgctgaagaagaaaaaagaggcttagacctgcgtgtgtcggggtac
ctgaatctggctgctgacttggcacacaacttcactgatggtctggccattggggcttcc
tttcgagggggccggggactagggatcctgaccacaatgactgtcctgctacatgaagtg
ccccacgaggtcggagactttgccatcttggtccagtctggctgcagcaaaaagcaggcg
atgcgtctgcaactactgacagcagtaggggcactggcaggcacagcctgtgcccttctc
actgaaggaggagcagtgggcagtgaaattgcaggtggtgcaggtcctggctgggtcctg
ccatttactgcaggtggctttatctacgtagcaacagtgtctgtgttgcccgagctgctg
agggaggcatcaccattgcaatcacttctggaggtgctggggctgctggggggagttatc
atgatggtgctgattgcccaccttgagtga

DBGET integrated database retrieval system