KEGG   Homo sapiens (human): 79290Help
Entry
79290             CDS       T01001                                 

Gene name
OR13A1
Definition
(RefSeq) olfactory receptor family 13 subfamily A member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    79290 (OR13A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    79290 (OR13A1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    79290 (OR13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 79290
NCBI-ProteinID: NP_001004297
HGNC: 14772
Ensembl: ENSG00000256574
Vega: OTTHUMG00000018080
Pharos: Q8NGR1(Tdark)
UniProt: Q8NGR1 A0A126GVD8
Position
10q11.21
AA seq 328 aa AA seqDB search
MKLWMESHLIVPETRPSPRMMSNQTLVTEFILQGFSEHPEYRVFLFSCFLFLYSGALTGN
VLITLAITFNPGLHAPMYFFLLNLATMDIICTSSIMPKALASLVSEESSISYGGCMAQLY
FLTWAASSELLLLTVMAYDRYAAICHPLHYSSMMSKVFCSGLATAVWLLCAVNTAIHTGL
MLRLDFCGPNVIIHFFCEVPPLLLLSCSSTYVNGVMIVLADAFYGIVNFLMTIASYGFIV
SSILKVKTAWGRQKAFSTCSSHLTVVCMYYTAVFYAYISPVSGYSAGKSKLAGLLYTVLS
PTLNPLIYTLRNKEVKAALRKLFPFFRN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtggatggagagtcacctgatagtcccagaaacccgtcccagcccaaggatg
atgagtaaccagacgttggtaaccgagttcatcctgcagggcttttcggagcacccagaa
taccgggtgttcttattcagctgtttcctcttcctctactctggggccctcacaggtaat
gtcctcatcaccttggccatcacgttcaaccctgggctccacgctcctatgtactttttc
ttactcaacttggctactatggacattatctgcacctcttccatcatgcccaaggcgctg
gccagtctggtgtcggaagagagctccatctcctacgggggctgcatggcccagctctat
ttcctcacgtgggctgcatcctcagagctgctgctcctcacggtcatggcctatgaccgg
tacgcagccatctgccacccgctgcattacagcagcatgatgagcaaggtgttctgcagc
gggctggccacagccgtgtggctgctctgcgccgtcaacacggccatccacacggggctg
atgctgcgcttggatttctgtggccccaatgtcattatccatttcttctgcgaggtccct
cccctgctgcttctctcctgcagctccacctacgtcaacggtgtcatgattgtcctggcg
gatgctttctacggcatagtgaacttcctgatgaccatcgcgtcctatggcttcatcgtc
tccagcatcctgaaggtgaagactgcctgggggaggcagaaagccttctccacctgctct
tcccacctcaccgtggtgtgcatgtattacaccgctgtcttctacgcctacataagcccg
gtctctggctacagcgcagggaagagcaagttggctggcctgctgtacactgtgctgagt
cctaccctcaaccccctcatctatactttgagaaacaaggaggtcaaagcagccctcagg
aagcttttccctttcttcagaaattaa

DBGET integrated database retrieval system