KEGG   Homo sapiens (human): 793Help
Entry
793               CDS       T01001                                 

Gene name
CALB1, CALB, D-28K
Definition
(RefSeq) calbindin 1
  KO
K14757  calbindin D28
Organism
hsa  Homo sapiens (human)
Pathway
hsa04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    793 (CALB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 793
NCBI-ProteinID: NP_004920
OMIM: 114050
HGNC: 1434
Ensembl: ENSG00000104327
Vega: OTTHUMG00000134314
Pharos: P05937(Tbio)
UniProt: P05937
Structure
PDB: 

Position
8q21.3
AA seq 261 aa AA seqDB search
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKT
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK
FQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMA
LSDGGKLYRTDLALILCAGDN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcccacctgcagtcatccctcatcacagcctcacagtttttcgagatctgg
ctccatttcgacgctgacggaagtggttacctggaaggaaaggagctgcagaacttgatc
caggagctccagcaggcgcgaaagaaggctggattggagttatcacctgaaatgaaaact
tttgtggatcagtatgggcaaagagatgatggaaaaataggaattgtagagttggctcac
gtattacccacagaagagaatttcctgctgctcttccgatgccagcagctgaagtcctgt
gaggaattcatgaagacatggagaaaatatgatactgaccacagtggcttcatagaaact
gaggagcttaagaactttctaaaggacctgctagaaaaagcaaacaagactgttgatgac
acaaaattagccgagtatacagacctaatgctgaaactatttgattcaaataatgatggg
aagctggaattaactgagatggccaggttactaccagtgcaggagaattttcttcttaaa
ttccagggaatcaaaatgtgtgggaaagagttcaataaggcttttgagctgtatgatcag
gacggcaatggatacatagatgaaaatgaactggatgctttactgaaggatctgtgcgag
aagaataaacaggatctggatattaataatattacaacatacaagaagaacataatggct
ttgtcggatggagggaagctgtaccgaacggatcttgctcttattctctgtgctggggat
aactag

DBGET integrated database retrieval system