KEGG   Homo sapiens (human): 79310Help
Entry
79310             CDS       T01001                                 

Gene name
OR5H2, OR3-10
Definition
(RefSeq) olfactory receptor family 5 subfamily H member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    79310 (OR5H2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    79310 (OR5H2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    79310 (OR5H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 79310
NCBI-ProteinID: NP_001005482
HGNC: 14752
Ensembl: ENSG00000197938
Vega: OTTHUMG00000160080
Pharos: Q8NGV7(Tdark)
UniProt: Q8NGV7
Position
3q11.2
AA seq 314 aa AA seqDB search
MSNEDMEQDNTTLLTEFVLTGLTYQPEWKMPLFLVFLVIYLITIVWNLGLIALIWNDPQL
HIPMYFFLGSLAFVDAWISSTVTPKMLVNFLAKNRMISLSECMIQFFSFAFGGTTECFLL
ATMAYDRYVAICKPLLYPVIMNNSLCIRLLAFSFLGGFLHALIHEVLIFRLTFCNSNIIH
HFYCDIIPLFMISCTDPSINFLMVFILSGSIQVFTIVTVLNSYTFALFTILKKKSVRGVR
KAFSTCGAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYSLRNK
QVIDSFTKMVKRNV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaggacatggaacaggataatacaacattgctgacagagtttgttctcaca
ggacttacatatcagccagagtggaaaatgcccctgttcttggtgttcttggtgatctat
ctcatcactattgtgtggaaccttggtctgattgctcttatctggaatgacccacaactt
cacatccccatgtacttttttcttgggagtttagcctttgttgatgcttggatatcttcc
acagtaactcccaaaatgttggttaatttcttggccaaaaacaggatgatatctctgtct
gaatgcatgattcaatttttttcctttgcatttggtggaactacagaatgttttctcttg
gcaacaatggcatatgatcgctatgtagccatatgcaaacctttactatatccagtgatt
atgaacaattcactatgcatacggctgttagccttctcatttttaggtggcttcctccat
gccttaattcatgaagtccttatattcagattaaccttctgcaattctaacataatacat
catttttactgtgatattataccactgtttatgatttcctgtactgacccttctattaat
tttctaatggtttttattttgtctggctcaattcaggtattcaccattgtgacagttctt
aattcttacacatttgctcttttcacaatcctaaaaaagaagtctgttagaggcgtaagg
aaagccttttccacctgtggagcccatctcttatctgtctctttatattatggcccactt
atcttcatgtatttgcgccctgcatctccacaagcagatgaccaagatatgatagactct
gtcttttatacaatcataattcctttgctaaatcccattatctacagtctgagaaataaa
caagtaatagattcattcacaaaaatggtaaaaagaaatgtttag

DBGET integrated database retrieval system