KEGG   Homo sapiens (human): 7932Help
Entry
7932              CDS       T01001                                 

Gene name
OR2H2, FAT11, OLFR2, OLFR42B, OR2H3, dJ271M21.2, hs6M1-12
Definition
(RefSeq) olfactory receptor family 2 subfamily H member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    7932 (OR2H2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7932 (OR2H2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    7932 (OR2H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 7932
NCBI-ProteinID: NP_009091
OMIM: 600578
HGNC: 8253
Ensembl: ENSG00000204657
Vega: OTTHUMG00000031052
Pharos: O95918(Tdark)
UniProt: O95918 A0A1U9X844
Position
6p22.1
AA seq 312 aa AA seqDB search
MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIILLSALDPKLHSPMYFF
LSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDR
YVAVCQPLHYATIIHPRLCWQLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVP
ALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWAVLRINSAKGRRKAFGTCS
SHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFR
RLLGKEMGLTQS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggttaaccaaagctccacaccgggcttcctccttctgggcttctctgaacacccaggg
ctggaaaggactctcttcgtggttgtcctcacttcctacctcctaaccctagtgggcaac
acactcatcatcctgctgtctgcgctggaccccaagctccactctccaatgtactttttc
ctctccaacctctccttcttggacctctgtttcaccacgagttgtgttccccaaatgctg
gtcaacctctggggcccaaagaagaccatcagcttcctggactgctctgtccagatcttc
atcttcctgtccctggggacaactgagtgcatcctcttgacagtgatggcttttgatcgc
tacgtggctgtctgccagcccctccactatgccaccatcatccacccccgcctgtgctgg
cagctggcatctgtggcctgggtcattgggctagtggagtcagtggtccagacaccatcc
accctgcacctgcccttctgccccgatcggcaggtggatgattttgtctgtgaggtccca
gctctaattcgactctcctgtgaagacacctcctacaatgagatccaggtggctgttgcc
agtgtcttcatcttggttgtgcctctcagcctcatccttgtctcttacggagccattacc
tgggcagtgctgaggattaactctgcaaaagggcggaggaaagcttttgggacctgctcc
tcccatctcactgtggtcaccctcttctacagctcagtcattgctgtctacctccagccc
aaaaatccctatgcccaagagaggggcaagttctttggtctcttctatgcagtgggcact
ccttcacttaaccctctcatatacaccctgaggaacaaggaggtaaccagggcattcagg
agattgctggggaaggaaatggggctcacacaaagctga

DBGET integrated database retrieval system