KEGG   Homo sapiens (human): 79324Help
Entry
79324             CDS       T01001                                 

Gene name
OR51G1, OR11-29, OR51G3P
Definition
(RefSeq) olfactory receptor family 51 subfamily G member 1 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    79324 (OR51G1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    79324 (OR51G1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    79324 (OR51G1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 79324
NCBI-ProteinID: NP_001005237
HGNC: 14738
Ensembl: ENSG00000278870
Vega: OTTHUMG00000066532
Pharos: Q8NGK1(Tdark)
UniProt: Q8NGK1 A0A126GVF5
Position
11p15.4
AA seq 321 aa AA seqDB search
MTILLNSSLQRATFFLTGFQGLEGLHGWISIPFCFIYLTVILGNLTILHVICTDATLHGP
MYYFLGMLAVTDLGLCLSTLPTVLGIFWFDTREIGIPACFTQLFFIHTLSSMESSVLLSM
SIDRYVAVCNPLHDSTVLTPACIVKMGLSSVLRSALLILPLPFLLKRFQYCHSHVLAHAY
CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYALILRTVLSIASHQERLRAL
NTCVSHICAVLLFYIPMIGLSLVHRFGEHLPRVVHLFMSYVYLLVPPLMNPIIYSIKTKQ
IRQRIIKKFQFIKSLRCFWKD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcttcttaatagcagcctccaaagagccactttcttcctgacgggcttccaa
ggtctagaaggtctccatggctggatctctattcccttctgcttcatctacctgacagtt
atcttggggaacctcaccattctccacgtcatttgtactgatgccactctccatggaccc
atgtactatttcttgggcatgctagctgtcacagacttaggcctttgcctttccacactg
cccactgtgctgggcattttctggtttgataccagagagattggcatccctgcctgtttc
actcagctcttcttcatccacaccttgtcttcaatggagtcatcagttctgttatccatg
tccattgaccgctacgtggccgtctgcaacccactgcatgactccaccgtcctgacacct
gcatgtattgtcaagatggggctaagctcagtgcttagaagtgctctcctcatcctcccc
ttgccattcctcctgaagcgcttccaatactgccactcccatgtgctggctcatgcttat
tgtcttcacctggagatcatgaagctggcctgctctagcatcattgtcaatcacatctat
gggctctttgttgtggcctgcaccgtgggtgtggactccctgctcatctttctctcatac
gccctcatccttcgcaccgtgctcagcattgcctcccaccaggagcgactccgagccctc
aacacctgtgtctctcatatctgtgctgtactgctcttctacatccccatgattggcttg
tctcttgtgcatcgctttggtgaacatctgccccgcgttgtacacctcttcatgtcctat
gtgtatctgctggtaccaccccttatgaaccccatcatctacagcatcaagaccaagcaa
attcgccagcgcatcattaagaagtttcagtttataaagtcacttaggtgtttttggaag
gattaa

DBGET integrated database retrieval system