KEGG   Homo sapiens (human): 79345Help
Entry
79345             CDS       T01001                                 

Gene name
OR51B2, HOR5'Beta3, OR51B1P
Definition
(RefSeq) olfactory receptor family 51 subfamily B member 2 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    79345 (OR51B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    79345 (OR51B2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    79345 (OR51B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 79345
NCBI-ProteinID: NP_149420
HGNC: 14703
Ensembl: ENSG00000279012
Vega: OTTHUMG00000066682
Pharos: Q9Y5P1(Tdark)
UniProt: Q9Y5P1 A0A126GWB2
Position
11p15.4
AA seq 312 aa AA seqDB search
MWPNITAAPFLLTGFPGLEAAHHWISIPFFAVYVCILLGNGMLLYLIKHDHSLHEPMYYF
LTMLAGTDLMVTLTTMPTVMGILWVNHREISSVGCFLQAYFIHSLSVVESGSLLAMAYDC
FIAIRNPLRYASILTNTRVIALGVGVFLRGFVSILPVILRLFSFSYCKSHVITRAFCLHQ
EIMRLACADITFNRLYPVILISLTIFLDCLIILFSYILILNTVIGIASGEERAKALNTCI
SHISCVLIFYVTVMGLTFIYRFGKNVPEVVHIIMSYIYFLFPPLMNPVIYSIKTKQIQYG
IIRLLSKHRFSS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccaatattactgcagccccttttttgctgactggctttccagggctggaggca
gctcatcactggatctccatccccttctttgctgtttatgtgtgcatccttctgggcaat
ggcatgctcctctacctcatcaagcatgaccacagtcttcatgagcccatgtactacttc
ctcaccatgctggcaggcacagacctcatggtgacattgaccacgatgcctactgtaatg
ggcatcctatgggtgaatcacagggagattagcagtgtgggctgcttcctacaggcttac
tttattcactccctttctgttgtggaatcaggttccctcctggcaatggcatatgattgt
ttcattgccatccgcaatcctttgagatatgcttccattctcaccaatactagagtcata
gcgttaggagtgggagtgtttctaaggggttttgtatccatcctgcctgtaattttgcgt
cttttttcattttcatattgcaaatctcatgttatcacacgtgctttctgcctccaccaa
gaaatcatgagactggcttgtgctgacataactttcaatagactttaccctgtaattttg
atctctttaacaatcttcctagactgtctgatcatcctcttctcctatattctaattctt
aatactgtcataggcattgcttctggtgaagagagagccaaagccctcaatacctgtatc
tcccacattagttgtgttcttatcttctatgttacagtgatgggtttgacattcatttac
agatttgggaagaatgtgccagaggttgtccacattatcatgagttacatctacttcctc
tttcctcctttaatgaaccctgtcatctacagcatcaaaaccaagcaaatacaatatggc
attatccgccttttatctaaacataggtttagtagttaa

DBGET integrated database retrieval system