KEGG   Homo sapiens (human): 79400Help
Entry
79400             CDS       T01001                                 

Gene name
NOX5
Definition
(RefSeq) NADPH oxidase 5
  KO
K21424  NADPH oxidase 5 [EC:1.6.3.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79400 (NOX5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-  
     79400 (NOX5)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    79400 (NOX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_6 FAD_binding_8 Ferric_reduct EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 NAD_binding_1 FAD_binding_6
Motif
Other DBs
NCBI-GeneID: 79400
NCBI-ProteinID: NP_078781
OMIM: 606572
HGNC: 14874
Ensembl: ENSG00000255346
Vega: OTTHUMG00000133320
Pharos: Q96PH1(Tbio)
UniProt: Q96PH1 A3QRJ0
Position
15q23
AA seq 765 aa AA seqDB search
MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESF
FAERFFALFDSDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTE
WGAGAGPHWASSPLGTGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADAD
GNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPRQLTRAYWHNHRSQLF
CLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATW
LAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRPGI
GWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFW
KWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLN
IPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVT
MRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASIL
QSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQ
AEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDW
SKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatctggagacccagcccagacgggccctgaaggctgtagaggcaccatgagt
gccgaggaggatgccaggtggctccggtgggtgactcagcagtttaagaccattgcagga
gaagatggggagatcagcctgcaagaattcaaagcagctctgcatgtgaaagagtccttc
tttgcagagcgattctttgccctatttgactccgatagaagtggcaccatcaccctccag
gagctgcaggaggcactgaccctgctcatccatggcagccccatggacaaactcaaattc
ctcttccaggtgtatgacatcgatgtgtgtgcacggcagggggcgtctgcaggtacagag
tggggtgctggggcaggcccgcactgggcttcatccccactcgggacaggcagtggctcc
attgacccggatgagctgcgcactgtgctgcagtcgtgtctgcgcgagagcgccatctcg
ctgcctgacgagaagctggaccagctgacgctggcgctcttcgaatcggccgacgcggac
ggcaacggggccatcaccttcgaggagctccgggacgagctgcagcgcttccccggagtc
atggagaacctgaccatcagcgctgcccactggctgacggcccccgccccccgcccacgc
ccgcgccggccgcgccagctgacccgcgcctactggcacaaccaccgcagccagctgttc
tgcctggccacctatgcaggcctccacgtgctgctcttcgggctggcggccagcgcgcac
cgggacctcggcgccagcgtcatggtggccaagggctgcggccagtgcctcaacttcgac
tgcagcttcatcgcggtgctgatgctcagacgctgcctcacctggctgcgggccacgtgg
ctggctcaagtcctaccactggaccagaacatccagttccaccagcttatgggctacgtg
gtagtggggctgtccctcgtgcacaccgtggctcacactgtgaactttgtactccaggct
caggcggaggccagccctttccagttctgggagctgctgctcaccacgaggcctggcatt
ggctgggtacacggttcggcctccccgacaggtgtcgctctgctgctgctgctcctcctc
atgttcatctgctccagttcctgcatccgcaggagtggccactttgaggtgttctattgg
actcacctgtcctacctcctcgtgtggcttctgctcatctttcatgggcccaacttctgg
aagtggctgctggtgcctggaatcttgtttttcctggagaaggccatcggactggcagtg
tcccgcatggcagccgtgtgcatcatggaagtcaacctcctcccctccaaggtcactcat
ctcctcatcaagcggccccctttttttcactatagacctggtgactacttgtatctgaac
atccccaccattgctcgctatgagtggcaccccttcaccatcagcagtgctcctgagcag
aaagacactatctggctgcacattcggtcccaaggccagtggacaaacaggctgtatgag
tccttcaaggcatcagacccactgggccgtggttctaagaggctgtcgaggagtgtgaca
atgagaaagagtcaaaggtcgtccaagggctctgagatacttttggagaaacacaaattc
tgtaacatcaagtgctacatcgatgggccttatgggacccccacccgcaggatctttgcc
tctgagcatgccgtgctcatcggggcaggcatcggcatcaccccctttgcttccattctg
cagagtatcatgtacaggcaccagaaaagaaagcatacttgccccagctgccagcactcc
tggatcgaaggtgtccaagacaacatgaagctccataaggtggactttatctggatcaac
agagaccagcggtctttcgagtggtttgtgagcctgctgactaaactggagatggaccag
gccgaggaggctcaatacggccgcttcctggagctgcatatgtacatgacatctgcactg
ggcaagaatgacatgaaggccattggcctgcagatggcccttgacctcctggccaacaag
gagaagaaagactccatcacggggctgcagacgcgcacccagcctgggcggcctgactgg
agcaaggtgttccagaaagtggctgctgagaagaagggcaaggtgcaggtcttcttctgt
ggctccccagctctggccaaggtgctgaagggccattgtgagaagttcggcttcagattt
ttccaagagaatttctag

DBGET integrated database retrieval system