KEGG   Homo sapiens (human): 79412Help
Entry
79412             CDS       T01001                                 

Gene name
KREMEN2, KRM2
Definition
(RefSeq) kringle containing transmembrane protein 2
  KO
K23091  kremen protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    79412 (KREMEN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kringle WSC CUB
Motif
Other DBs
NCBI-GeneID: 79412
NCBI-ProteinID: NP_757384
OMIM: 609899
HGNC: 18797
Ensembl: ENSG00000131650
Vega: OTTHUMG00000128976
Pharos: Q8NCW0(Tdark)
UniProt: Q8NCW0 Q53F67
Position
16p13.3
AA seq 462 aa AA seqDB search
MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYG
PDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLG
TAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGA
PPAAIGARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAPGKGPPALGASRGPRRSWAVWY
QQPRGVALPCSPGDPQAEGSAAGYRPLSASSQSSLRSLISAL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggggacacaagccctgcagggcttcctctttctcctcttcctcccgctgctgcagccg
cgtggggcctcggctgggagcctgcacagtccaggcctgtccgaatgcttccaggtgaat
ggggctgactaccgcggccaccagaaccgcactggcccgcgcggggcgggccgcccgtgc
ctcttctgggaccagacgcagcaacacagctacagcagcgccagcgacccccacggccgc
tgggggctgggcgcgcacaacttctgccgtaacccagacggtgacgtgcagccgtggtgc
tacgtggctgagacagaggagggcatctactggcgctactgcgacatcccctcctgtcac
atgccaggctacctgggatgctttgtggactcaggggcacccccagccctcagcggcccc
agcggcacctccacgaagctcacggtccaggtgtgcctacgcttctgccgcatgaagggg
taccagctggcgggcgtggaggccggttacgcctgcttctgtggctctgaaagcgacctg
gcccggggacgcctggcccccgccaccgactgtgaccagatctgtttcggccaccctgga
cagctgtgtggcggcgatgggcggctgggcgtctatgaagtgtcggtgggctcctgccag
gggaactggacagcgcctcagggcgtcatctactccccggacttcccggacgagtacggg
ccggaccggaactgcagctgggccctgggcccgccaggcgccgcgctggagctcaccttc
cgcctcttcgagctggccgacccgcgcgaccggctggagctgcgcgacgcggcttcgggc
agcctgctccgcgccttcgatggcgcccgcccaccgccgtccgggccgctgcgcctgggc
actgccgcgctgctgctcaccttccgaagcgacgcgcgcggccacgcgcaaggcttcgcg
ctcacctaccgcgggctgcaggacgccgctgaggacccagaggcccccgagggctcggcc
cagacccccgcggcgcccctcgacggggccaacgtgagctgcagccccaggcctggggct
ccgccggccgcgattggggcccgggtcttctcgacggtgacggctgtctcggtgctgctg
ctgctgctcctggggctgctgcgtccgctgcgccgacggagctgtctgctggctccggga
aaagggcccccggcgctgggggcttccaggggccccaggagaagctgggctgtgtggtac
caacagccccgaggggtggccttgccctgctcccccggggacccccaggctgagggttct
gccgcgggctaccggcctctgagtgcctccagccagagctccctgcgctcgctcatctcc
gctctctga

DBGET integrated database retrieval system