KEGG   Homo sapiens (human): 7942
Entry
7942              CDS       T01001                                 
Symbol
TFEB, ALPHATFEB, BHLHE35, TCFEB
Name
(RefSeq) transcription factor EB
  KO
K15590  transcription factor EB
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7942 (TFEB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7942 (TFEB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    7942 (TFEB)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH
Other DBs
NCBI-GeneID: 7942
NCBI-ProteinID: NP_001258873
OMIM: 600744
HGNC: 11753
Ensembl: ENSG00000112561
Pharos: P19484(Tbio)
UniProt: P19484 A0A024RCY3
Position
6:complement(41683978..41736223)
AA seq 476 aa
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQ
SPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPA
ASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQM
PNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNH
NLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELEN
HSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEAL
MLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG
HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcgtcacgcatagggttgcgcatgcagctcatgcgggagcaggcgcagcaggaggag
cagcgggagcgcatgcagcaacaggctgtcatgcattacatgcagcagcagcagcagcag
caacagcagcagctcggagggccgcccaccccggccatcaatacccccgtccacttccag
tcgccaccacctgtgcctggggaggtgttgaaggtgcagtcctacctggagaatcccaca
tcctaccatctgcagcagtcgcagcatcagaaggtgcgggagtacctgtccgagacctat
gggaacaagtttgctgcccacatcagcccagcccagggctctccgaaacccccaccagcc
gcctccccaggggtgcgagctggacacgtgctgtcctcctccgctggcaacagtgctccc
aatagccccatggccatgctgcacattggctccaaccctgagagggagttggatgatgtc
attgacaacattatgcgtctggacgatgtccttggctacatcaatcctgaaatgcagatg
cccaacacgctacccctgtccagcagccacctgaatgtgtacagcagcgacccccaggtc
acagcctccctggtgggcgtcaccagcagctcctgccctgcggacctgacccagaagcga
gagctcacagatgctgagagcagggccctggccaaggagcggcagaagaaagacaatcac
aacttaattgaaaggagacgaaggttcaacatcaatgaccgcatcaaggagttgggaatg
ctgatccccaaggccaatgacctggacgtgcgctggaacaagggcaccatcctcaaggcc
tctgtggattacatccggaggatgcagaaggacctgcaaaagtccagggagctggagaac
cactctcgccgcctggagatgaccaacaagcagctctggctccgtatccaggagctggag
atgcaggctcgagtgcacggcctccctaccacctccccgtccggcatgaacatggctgag
ctggcccagcaggtggtgaagcaggagctgcctagcgaagagggcccaggggaggccctg
atgctgggggctgaggtccctgaccctgagccactgccagctctgcccccgcaagccccg
ctgcccctgcccacccagccaccatccccattccatcacctggacttcagccacagcctg
agctttgggggcagggaggacgagggtcccccgggctaccccgaacccctggcgccgggg
catggctccccattccccagcctgtccaagaaggatctggacctcatgctcctggacgac
tcactgctaccgctggcctctgatccacttctgtccaccatgtcccccgaggcctccaag
gccagcagccgccggagcagcttcagcatggaggagggcgatgtgctgtga

DBGET integrated database retrieval system