KEGG   Homo sapiens (human): 79447
Entry
79447             CDS       T01001                                 

Gene name
PAGR1, C16orf53, GAS, PA1
Definition
(RefSeq) PAXIP1 associated glutamate rich protein 1
  KO
K14973  PAXIP1-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79447 (PAGR1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     79447 (PAGR1)
SSDB
Motif
Pfam: PAXIP1_C
Other DBs
NCBI-GeneID: 79447
NCBI-ProteinID: NP_078792
OMIM: 612033
HGNC: 28707
Ensembl: ENSG00000280789
Vega: OTTHUMG00000177143
Pharos: Q9BTK6(Tdark)
UniProt: Q9BTK6
Position
16p11.2
AA seq 254 aa
MSLARGHGDTAASTAAPLSEEGEVTSGLQALAVEDTGGPSASAGKAEDEGEGGREETERE
GSGGEEAQGEVPSAGGEEPAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLA
AHGTLELQAEILPRRPPTPEAQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDS
LIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEDPSPASPPL
RSSGSSLFPRQRKY
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtcccttgctcggggccatggagacactgcggccagtacggcggcgcctctgtctgaa
gaaggggaagtgacctccggcctccaggctctggccgtggaggataccggaggcccctct
gcctcggccggtaaggccgaggacgagggggaaggaggccgagaggagaccgagcgtgag
gggtccgggggcgaggaggcgcagggagaagtccccagcgctgggggagaagagcctgcc
gaggaggactccgaggactggtgcgtgccctgcagcgacgaggaggtggagctgcctgcg
gatgggcagccctggatgcccccgccctccgaaatccagcggctctatgaactgctggct
gcccacggtactctggagctgcaagccgagatcctgccccgccggcctcccacgccggag
gcccagagcgaagaggagagatccgatgaggagccggaggccaaagaagaggaagaggaa
aaaccacacatgcccacggaatttgattttgatgatgagccagtgacaccaaaggactcc
ctgattgaccggagacgcaccccaggaagctcagcccggagccagaaacgggaggcccgc
ctggacaaggtgctgtcggacatgaagagacacaagaagctggaggagcagatccttcgt
accgggagggacctcttcagcctggactcggaggaccccagccccgccagccccccactc
cgatcctccgggagtagtctcttccctcggcagcggaaatactga

DBGET integrated database retrieval system