KEGG   Homo sapiens (human): 79465Help
Entry
79465             CDS       T01001                                 

Gene name
ULBP3, N2DL-3, NKG2DL3, RAET1N
Definition
(RefSeq) UL16 binding protein 3
  KO
K07986  UL16 binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    79465 (ULBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I MHC_I_2 MHC_I_3 Gag_p6
Motif
Other DBs
NCBI-GeneID: 79465
NCBI-ProteinID: NP_078794
OMIM: 605699
HGNC: 14895
Ensembl: ENSG00000131019
Vega: OTTHUMG00000015811
Pharos: Q9BZM4(Tbio)
UniProt: Q9BZM4
Structure
PDB: 

Position
6q25.1
AA seq 244 aa AA seqDB search
MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQK
NFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPL
TLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLT
TFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPGLAQPKAIATTLSPWSFLIILCFI
LPGI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccgccagccccgcgatccttccgcgcctcgcgattcttccgtacctgcta
ttcgactggtccgggacggggcgggccgacgctcactctctctggtataacttcaccatc
attcatttgcccagacatgggcaacagtggtgtgaggtccagagccaggtggatcagaag
aattttctctcctatgactgtggcagtgacaaggtcttatctatgggtcacctagaagag
cagctgtatgccacagatgcctggggaaaacaactggaaatgctgagagaggtggggcag
aggctcagactggaactggctgacactgagctggaggatttcacacccagtggacccctc
acgctgcaggtcaggatgtcttgtgagtgtgaagccgatggatacatccgtggatcttgg
cagttcagcttcgatggacggaagttcctcctctttgactcaaacaacagaaagtggaca
gtggttcacgctggagccaggcggatgaaagagaagtgggagaaggatagcggactgacc
accttcttcaagatggtctcaatgagagactgcaagagctggcttagggacttcctgatg
cacaggaagaagaggctggaacccacagcaccacccaccatggccccaggcttagctcaa
cccaaagccatagccaccaccctcagtccctggagcttcctcatcatcctctgcttcatc
ctccctggcatctga

KEGG   Homo sapiens (human): 80328Help
Entry
80328             CDS       T01001                                 

Gene name
ULBP2, ALCAN-alpha, N2DL2, NKG2DL2, RAET1H, RAET1L
Definition
(RefSeq) UL16 binding protein 2
  KO
K07986  UL16 binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    80328 (ULBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I MHC_I_2
Motif
Other DBs
NCBI-GeneID: 80328
NCBI-ProteinID: NP_079493
OMIM: 605698
HGNC: 14894
Ensembl: ENSG00000131015
Vega: OTTHUMG00000015803
Pharos: Q9BZM5(Tbio)
UniProt: Q9BZM5
Position
6q25.1
AA seq 246 aa AA seqDB search
MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLT
LQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAM
SFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPC
FILPGI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccgccgctaccaagatccttctgtgcctcccgcttctgctcctgctgtcc
ggctggtcccgggctgggcgagccgaccctcactctctttgctatgacatcaccgtcatc
cctaagttcagacctggaccacggtggtgtgcggttcaaggccaggtggatgaaaagact
tttcttcactatgactgtggcaacaagacagtcacacctgtcagtcccctggggaagaaa
ctaaatgtcacaacggcctggaaagcacagaacccagtactgagagaggtggtggacata
cttacagagcaactgcgtgacattcagctggagaattacacacccaaggaacccctcacc
ctgcaggcaaggatgtcttgtgagcagaaagctgaaggacacagcagtggatcttggcag
ttcagtttcgatgggcagatcttcctcctctttgactcagagaagagaatgtggacaacg
gttcatcctggagccagaaagatgaaagaaaagtgggagaatgacaaggttgtggccatg
tccttccattacttctcaatgggagactgtataggatggcttgaggacttcttgatgggc
atggacagcaccctggagccaagtgcaggagcaccactcgccatgtcctcaggcacaacc
caactcagggccacagccaccaccctcatcctttgctgcctcctcatcatcctcccctgc
ttcatcctccctggcatctga

KEGG   Homo sapiens (human): 80329Help
Entry
80329             CDS       T01001                                 

Gene name
ULBP1, N2DL-1, NKG2DL1, RAET1I
Definition
(RefSeq) UL16 binding protein 1
  KO
K07986  UL16 binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    80329 (ULBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I MHC_I_2 MHC_II_beta
Motif
Other DBs
NCBI-GeneID: 80329
NCBI-ProteinID: NP_079494
OMIM: 605697
HGNC: 14893
Ensembl: ENSG00000111981
Vega: OTTHUMG00000015810
Pharos: Q9BZM6(Tbio)
UniProt: Q9BZM6
Position
6q25.1
AA seq 244 aa AA seqDB search
MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERP
FLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLT
LQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTM
FFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFI
LAGR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccgccagccccgcgttccttctgtgcctcccgcttctgcacctgctgtct
ggctggtcccgggcaggatgggtcgacacacactgtctttgctatgacttcatcatcact
cctaagtccagacctgaaccacagtggtgtgaagttcaaggcctggtggatgaaaggcct
tttcttcactatgactgtgttaaccacaaggccaaagcctttgcttctctggggaagaaa
gtcaatgtcacaaaaacctgggaagaacaaactgaaacactaagagacgtggtggatttc
cttaaagggcaactgcttgacattcaagtggagaatttaatacccattgagcccctcacc
ctgcaggccaggatgtcttgtgagcatgaagcccatggacacggcagaggatcttggcag
ttcctcttcaatggacagaagttcctcctctttgactcaaacaacagaaagtggacagca
cttcatcctggagccaagaagatgacagagaagtgggagaagaacagggatgtgaccatg
ttcttccagaagatttcactgggggattgtaagatgtggcttgaagaatttttgatgtac
tgggaacaaatgctggatccaacaaaaccaccctctctggccccaggcacaacccaaccc
aaggccatggccaccaccctcagtccctggagccttctcatcatcttcctctgcttcatt
ctagctggcagatga

DBGET integrated database retrieval system