KEGG   Homo sapiens (human): 79482
Entry
79482             CDS       T01001                                 

Gene name
OR5AL1, OR5AL1P
Definition
(RefSeq) olfactory receptor family 5 subfamily AL member 1 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    79482 (OR5AL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    79482 (OR5AL1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    79482 (OR5AL1)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 79482
NCBI-ProteinID: NP_001335159
HGNC: 14844
Ensembl: ENSG00000272987
Vega: OTTHUMG00000154218
UniProt: P0C617
Position
11q12.1
AA seq 329 aa
MCALKGFLEENFYTYSVAKGNHSTVYEFILLGLTDNAELQVTLFGIFLVVYLASFMGNFG
LIMLIQISPQLHTPMYFFLSHLAFVDFSFTSSVAPNTLVNFLCEVKSITFYACAIQVCCF
ITFVVCELYLLSIMAYDRYVAICNPLLYVILIPRKLCIKLIASTYVYGFTVGLVQTVATS
YLSFCDSNVINHFYHDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVLISYGFIFFA
ILRIHSAEGRQKAFSTSASHLTSITIFYGTIIFMYPQPKSSHSLNMDKVASVFNVVVIPT
LNPLIYSLRNQEVKNALKRIIEKLCLAVK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtgtgctctaaagggttttctggaagaaaacttttatacctactcagtggccaaaggc
aatcattcaacagtgtatgaatttatcctcttggggctcacagataatgcagagcttcaa
gtcactctctttggtatattccttgtagtatacttagctagctttatgggtaatttcggt
ttgattatgctaattcaaatcagtcctcagcttcatacacccatgtattttttcctcagc
catctggcttttgttgatttttcttttacttcatctgttgccccaaataccttggtaaat
tttctgtgtgaagttaaaagtataacattttatgcatgtgccattcaggtatgctgcttc
atcacatttgtagtttgtgaattatatttgctctcaatcatggcatatgatcggtatgtt
gccatctgtaaccctttactttatgtcattctcattcctagaaaactctgtattaaactg
attgctagcacgtatgtgtatggattcactgtgggacttgtacagacagtggcgacatcc
tacttgtctttttgtgattccaacgtgatcaaccacttctaccatgatgatgttccatta
gtggctctggcctgttctgacactcatgtcaaagagctgatgttgttaatcattgctggg
ttcaatactctctgctctctagtaattgtgctgatttcttatggtttcattttctttgcc
atcctgaggatacattctgctgaagggagacagaaagcattttctaccagtgcttcccat
ctgacctccatcacaatattttatggaacaatcatttttatgtacccgcagcccaagtca
agccattccctgaatatggataaagttgcttctgtgtttaatgtggtagtgattcctaca
ttaaacccactgatctatagtttaagaaatcaggaggtaaaaaatgcactaaagagaatt
atagaaaagttatgtttggctgtcaaataa

DBGET integrated database retrieval system