KEGG   Homo sapiens (human): 79571Help
Entry
79571             CDS       T01001                                 

Gene name
GCC1, GCC1P, GCC88
Definition
(RefSeq) GRIP and coiled-coil domain containing 1
  KO
K20281  GRIP and coiled-coil domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    79571 (GCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRIP LPP SBD_N
Motif
Other DBs
NCBI-GeneID: 79571
NCBI-ProteinID: NP_078799
OMIM: 607418
HGNC: 19095
Ensembl: ENSG00000179562
Vega: OTTHUMG00000023590
Pharos: Q96CN9(Tdark)
UniProt: Q96CN9 A4D0Z4
Position
7q32.1
AA seq 775 aa AA seqDB search
MEKFGMNFGGGPSKKDLLETIETQKKQLLQYQARLKDVVRAYKSLLKEKEALEASIKVLS
VSHEADVGLAGVQLPGLTFPDSVDDRCSTHSEDSTGTATSLDTAASLTSTKGEFGVEDDR
PARGPPPPKSEEASWSESGVSSSSGDGPFAGGEVDKRLHQLKTQLATLTSSLATVTQEKS
RMEASYLADKKKMKQDLEDASNKAEEERARLEGELKGLQEQIAETKARLITQQHDRAQEQ
SDHALMLRELQKLLQEERTQRQDLELRLEETREALAGRAYAAEQMEGFELQTKQLTREVE
ELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMRKTALAEDQLRQQSQVEE
QRVAALENQISEVSELLGTYEKAKQKDQLAIQKLKERILQLDLENKTLALAASSRSPLDS
HGEESSLDVNVLKDKMEKLKRLLQVAARKSQVTLDVEKLCDLEIMPSSEAADGEKATALY
YQQELKQLKEEFERYKMRAQVVLKSKNTKDGNLGKELEAAQEQLAELKEKYISLRLSCEE
LEHQHQQEADDWKQELARLQQLHRQELERCQLDFRDRTLKLEEELHKQRDRALAVLTEKD
LELEQLRSVALASGLPGRRSPVGGGGPGDPADTSSSDSLTQALQLAAANEPTFFLYAEQL
ARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANL
EYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPTSASWWPSGKR
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtttgggatgaatttcgggggcggcccgagcaagaaggacttgctggagact
atagagacccagaagaagcagcttctccagtaccaggcacggctcaaggatgtggtccgt
gcctataaaagcctgctgaaggagaaagaggcattagaggccagcatcaaggtgctgtcg
gtatcccacgaggcagatgtgggcctcgcaggtgtccagcttccaggcctcacctttcct
gactctgtggatgaccggtgctccactcacagcgaggatagcactgggaccgccactagc
ttggatactgcggccagtctcaccagcaccaagggtgagtttggggtagaagatgacaga
ccggcccgtggaccaccacctccaaagtccgaagaggccagttggtccgagagtggcgtt
agcagtagcagtggggatgggccatttgcaggtggggaggtggacaaaagactgcaccag
ctgaagactcagttggctactttgaccagttctttggctacagtcactcaggagaagtcc
cgcatggaggcttcttacttggctgacaagaaaaagatgaaacaggacttagaggatgcc
agtaacaaggcggaggaggagagggcccgcctggagggagaattgaaggggctgcaggag
caaatagcagaaaccaaagcccggcttatcacgcagcagcatgatcgggcccaagagcag
agtgaccatgccttgatgctgcgtgagctccagaagctgctgcaggaggagaggacccag
cgccaggacttggagcttaggttagaagagacccgagaagccttggcaggacgagcatat
gcagctgaacagatggaaggatttgaactgcagaccaagcagctgacccgtgaggtggag
gagctgaaaagtgaactgcaggccattcgagatgagaagaatcagccagatccccggctg
caagaacttcaggaagaggctgcccgccttaagagccatttccaggctcagttacagcag
gaaatgagaaagacagctcttgcagaggatcaactccgtcagcaatctcaggtagaagaa
cagagggtggcagccctggagaatcaaatatccgaggtgtctgagctgctaggcacctac
gagaaagccaagcagaaggaccagctggccattcagaagctgaaggagcgcattctgcag
ctggacctggagaacaagacactggctctagcagcctccagcaggtcccctttagacagc
catggagaggagtccagtctggatgtcaatgtcctgaaagataagatggagaagctgaag
aggctgctgcaggttgcggccaggaaaagccaggtgaccctggatgtggagaagctctgt
gacctggagataatgcccagctcggaggctgctgatggggagaaggctactgcactctat
taccaacaggagctgaaacagctgaaggaagagtttgagaggtacaagatgagagcccag
gttgtcctcaaaagcaagaataccaaagatggtaacctgggaaaggagctggaggcagcc
caggaacagcttgcagagctgaaggagaagtatatttccctgcggctctcctgcgaggag
ctggagcaccaacaccagcaggaggctgatgactggaagcaggagctggcccggctgcag
cagctccaccggcaggagctggagcggtgccagctggacttcagggaccgcacactgaaa
ctggaggaggagctgcacaagcagcgggatcgtgccctagctgtgctcaccgagaaggac
ttggaactggagcaactgcgttctgtggccttggcctctgggctgccaggacgcagaagt
cctgtgggtggtggcggtcctggggacccagctgacacatcatcctctgatagcctgacc
caagcattacaacttgcagcggccaatgagcccactttctttctgtacgctgagcaactg
gcccgcaaggaggtggagatcacatcactgaggaagcagaagcacaggctggaggtcgag
gtgcatcagctgcaggatcggctgctggaggagggcgaacggcatcgtgaggaggttgca
gccctgcagagccacatcgaaaagaacatcagggaccagagcagggagggagccaatctg
gagtacctcaaaaacatcatctaccgcttcctgaccttacctgactccctgggccgccag
cagactctcacagccatactgactatcttgcacttcagtccagaggagaaacaagtgata
atgcgactcccaaccagtgccagctggtggccttctggcaagagatga

DBGET integrated database retrieval system