KEGG   Homo sapiens (human): 79572Help
Entry
79572             CDS       T01001                                 

Gene name
ATP13A3, AFURS1
Definition
(RefSeq) ATPase 13A3
  KO
K14951  cation-transporting P-type ATPase 13A3/4/5 [EC:7.2.2.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    79572 (ATP13A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5-ATPase E1-E2_ATPase Hydrolase Cation_ATPase_C Cation_ATPase Cation_ATPase_N FapA
Motif
Other DBs
NCBI-GeneID: 79572
NCBI-ProteinID: NP_078800
OMIM: 610232
HGNC: 24113
Ensembl: ENSG00000133657
Vega: OTTHUMG00000156034
Pharos: Q9H7F0(Tdark)
UniProt: Q9H7F0
Position
3q29
AA seq 1226 aa AA seqDB search
MDREERKTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCV
RAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTE
ENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLT
KGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVV
MSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLN
GTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDVKGIGDELYNPETHKRHTLF
CGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAV
AGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFC
ISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVENARFLSPEENVCNEMLVKSQFVA
CMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPE
STPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAG
LCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLI
IMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEALPPK
DGKVAKINWHYADSLTQCSHPSAIDPEAIPVKLVHDSLEDLQMTRYHFAMNGKSFSVILE
HFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISL
SELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSIL
SNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGF
QSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFIS
SFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPY
QWRVTMLIIVLVNAFVSITVEESVDRWGKCCLPWALGCRKKTPKAKYMYLAQELLVDPEW
PPKPQTTTEAKALVKENGSCQIITIT
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atggacagggaagaaaggaagaccatcaatcagggtcaagaagatgaaatggagatttat
ggttacaatttgagtcgctggaagcttgccatagtttctttaggagtgatttgctctggt
gggtttctcctcctcctcctctattggatgcctgagtggcgggtgaaagcgacctgtgtc
agagctgcaattaaagactgtgaagtagtgctgctgaggactactgatgaattcaaaatg
tggttttgtgcaaaaattcgcgttctttctttggaaacttacccagtttcaagtccaaaa
tctatgtctaataagctttcaaatggccatgcagtttgtttaattgagaatcccactgaa
gaaaataggcacaggatcagtaaatattcacagactgaatcacaacagattcgttatttc
acccaccatagtgtaaaatatttctggaatgataccattcacaattttgatttcttaaag
ggactggatgaaggtgtttcttgtacgtcaatttatgaaaagcatagtgcaggactgaca
aaggggatgcatgcctacagaaaactgctttatggagtaaatgaaattgctgtaaaagtg
ccttctgtttttaagcttctaattaaagaggttctcaacccattttacattttccagctg
ttcagtgttatactgtggagcactgatgaatactattactatgctctagctattgtggtt
atgtccatagtatcaatcgtaagctcactatattccattagaaagcaatatgttatgttg
catgacatggtggcaactcatagtaccgtaagagtttcagtttgtagagtaaatgaagaa
atagaagaaatcttttctaccgaccttgtgccaggagatgtcatggtcattccattaaat
gggacaataatgccttgtgatgctgtgcttattaatggtacctgcattgtaaacgaaagc
atgttaacaggagaaagtgttccagtgacaaagactaatttgccaaatccttcagtggat
gtgaaaggaataggagatgaattatataatccagaaacacataaacgacatactttgttt
tgtgggacaactgttattcagactcgtttctacactggagaactcgtcaaagccatagtt
gttagaacaggatttagtacttccaaaggacagcttgttcgttccatattgtatcccaaa
ccaactgattttaaactctacagagatgcctacttgtttctactatgtcttgtggcagtt
gctggcattgggtttatctacactattattaatagcattttaaatgaggtacaagttggg
gtcataattatcgagtctcttgatattatcacaattactgtgccccctgcacttcctgct
gcaatgactgctggtattgtgtatgctcagagaagactgaaaaaaatcggtattttctgt
atcagtcctcaaagaataaatatttgtggacagctcaatcttgtttgctttgacaagact
ggaactctaactgaagatggtttagatctttgggggattcaacgagtggaaaatgcacga
tttctttcaccagaagaaaatgtgtgcaatgagatgttggtaaaatcccagtttgttgct
tgtatggctacttgtcattcacttacaaaaattgaaggagtgctctctggtgatccactt
gatctgaaaatgtttgaggctattggatggattctggaagaagcaactgaagaagaaaca
gcacttcataatcgaattatgcccacagtggttcgtcctcccaaacaactgcttcctgaa
tctacccctgcaggaaaccaagaaatggagctgtttgaacttccagctacttatgagata
ggaattgttcgccagttcccattttcttctgctttgcaacgtatgagtgtggttgccagg
gtgctgggggataggaaaatggacgcctacatgaaaggagcgcccgaggccattgccggt
ctctgtaaacctgaaacagttcctgtcgattttcaaaacgttttggaagacttcactaaa
cagggcttccgtgtgattgctcttgcacacagaaaattggagtcaaaactgacatggcat
aaagtacagaatattagcagagatgcaattgagaacaacatggattttatgggattaatt
ataatgcagaacaaattaaagcaagaaacccctgcagtacttgaagatttgcataaagcc
aacattcgcaccgtcatggtcacaggtgacagtatgttgactgctgtctctgtggccaga
gattgtggaatgattctacctcaggataaagtgattattgctgaagcattacctccaaag
gatgggaaagttgccaaaataaattggcattatgcagactccctcacgcagtgcagtcat
ccatcagcaattgacccagaggctattccggttaaattggtccatgatagcttagaggat
cttcaaatgactcgttatcattttgcaatgaatggaaaatcattctcagtgatactggag
cattttcaagaccttgttcctaagttgatgttgcatggcaccgtgtttgcccgtatggca
cctgatcagaagacacagttgatagaagcattgcaaaatgttgattattttgttgggatg
tgtggtgatggcgcaaatgattgtggtgctttgaagagggcacacggaggcatttcctta
tcggagctcgaagcttcagtggcatctccctttacctctaagactcctagtatttcctgt
gtgccaaaccttatcagggaaggccgtgctgctttaataacttccttctgtgtgtttaaa
ttcatggcattgtacagcattatccagtacttcagtgttactctgctgtattctatctta
agtaacctaggagacttccagtttctcttcattgatctggcaatcattttggtagtggta
tttacaatgagtttaaatcctgcctggaaagaacttgtggcacaaagaccaccttcgggt
cttatatctggggcccttctcttctccgttttgtctcagattatcatctgcattggattt
caatctttgggttttttttgggtcaaacagcaaccttggtatgaagtgtggcatccaaaa
tcagatgcttgtaatacaacaggaagcgggttttggaattcttcacacgtagacaatgaa
accgaacttgatgaacataatatacaaaattatgaaaataccacagtgttttttatttcc
agttttcagtacctcatagtggcaattgccttttcaaaaggaaaacccttcaggcaacct
tgctacaaaaattatttttttgttttttctgtgatttttttatatatttttatattattc
atcatgttgtatccagttgcctctgttgaccaggttcttcagatagtgtgtgtaccatat
cagtggcgtgtaactatgctcatcattgttcttgtcaatgcctttgtgtctatcacagtg
gaggagtcagtggatcggtggggaaaatgctgcttaccctgggccctgggctgtagaaag
aagacaccaaaggcaaagtacatgtatctggcgcaggagctcttggttgatccagaatgg
ccaccaaaacctcagacaaccacagaagctaaagctttagttaaggagaatggatcatgt
caaatcatcaccataacatag

DBGET integrated database retrieval system