KEGG   Homo sapiens (human): 79577Help
Entry
79577             CDS       T01001                                 

Gene name
CDC73, C1orf28, FIHP, HPTJT, HRPT1, HRPT2, HYX
Definition
(RefSeq) cell division cycle 73
  KO
K15175  parafibromin
Organism
hsa  Homo sapiens (human)
Disease
H00246  Primary hyperparathyroidism
H01558  Parathyroid carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    79577 (CDC73)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    PAF1 complex
     79577 (CDC73)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDC73_N CDC73_C
Motif
Other DBs
NCBI-GeneID: 79577
NCBI-ProteinID: NP_078805
OMIM: 607393
HGNC: 16783
Ensembl: ENSG00000134371
Vega: OTTHUMG00000035676
Pharos: Q6P1J9(Tbio)
UniProt: Q6P1J9
Structure
PDB: 

Position
1q31.2
AA seq 531 aa AA seqDB search
MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSI
LFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQR
STQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVE
KIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS
TGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKG
KEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTP
IIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAIS
VTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY
DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtgcttagcgtcctgcgacagtacaacatccagaagaaggagattgtggtg
aagggagacgaagtgatcttcggggagttctcctggcccaagaatgtgaagaccaactat
gttgtttgggggactggaaaggaaggccaacccagagagtactacacattggattccatt
ttatttctacttaataacgtgcacctttctcatcctgtttatgtccgacgtgcagctact
gaaaatattcctgtggttagaagacctgatcgaaaagatctacttggatatctcaatggt
gaagcgtcaacatcggcaagtatagacagaagcgctcccttagaaataggtcttcagcga
tctactcaagtcaaacgagctgcagatgaagttttagcagaagcaaagaaaccacgaatt
gaggatgaagagtgtgtgcgccttgataaagagagattggctgcccgtttggagggtcac
aaagaagggattgtacagactgaacagattaggtctttgtctgaagctatgtcagtggaa
aaaattgctgcaatcaaagccaaaattatggctaagaaaagatctactatcaagactgat
ctagatgatgacataactgcccttaaacagaggagttttgtggatgctgaggtagatgtg
acccgagatattgtcagcagagagagagtatggaggacacgaacaactatcttacaaagc
acaggaaagaatttttccaagaacatttttgcaattcttcaatctgtaaaagccagagaa
gaagggcgtgcacctgaacagcgacctgccccaaatgcagcacctgtggatcccactttg
cgcaccaaacagcctatcccagctgcctataacagatacgatcaggaaagattcaaagga
aaagaagaaacggaaggcttcaaaattgacactatgggaacctaccatggtatgacactg
aaatctgtaacggagggtgcatctgcccggaagactcagactcctgcagcccagccagta
ccaagaccagtttctcaagcaagacctcccccaaatcagaagaaaggatctcgaacaccc
attatcataattcctgcagctaccacctctttaataaccatgcttaatgcaaaagacctt
ctacaggacctgaaatttgtcccatcagatgaaaagaagaaacaaggttgtcaacgagaa
aatgaaactctaatacaaagaagaaaagaccagatgcaaccagggggcactgcaattagt
gttacagtaccttatagagtagtagaccagccccttaaacttatgcctcaagactgggac
cgcgttgtagccgtttttgtgcagggtcctgcatggcagttcaaaggttggccatggctt
ttgcctgatggatcaccagttgatatatttgctaaaattaaagccttccatctgaagtat
gatgaagttcgtctggatccaaatgttcagaaatgggatgtaacagtattagaactcagc
tatcacaaacgtcatttggatagaccagtgttcttacggttttgggaaacattggacagg
tacatggtaaagcataaatcgcacttgagattctga

DBGET integrated database retrieval system