KEGG   Homo sapiens (human): 79581
Entry
79581             CDS       T01001                                 
Symbol
SLC52A2, BVVLS2, D15Ertd747e, GPCR41, GPR172A, PAR1, RFT3, RFVT2, hRFT3
Name
(RefSeq) solute carrier family 52 member 2
  KO
K22117  riboflavin transporter 1/3
Organism
hsa  Homo sapiens (human)
Disease
H01903  Brown-Vialetto-Van Laere syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    79581 (SLC52A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC52: Riboflavin transporter
   79581 (SLC52A2)
SSDB
Motif
Pfam: DUF1011
Other DBs
NCBI-GeneID: 79581
NCBI-ProteinID: NP_001240744
OMIM: 607882
HGNC: 30224
Ensembl: ENSG00000185803
Pharos: Q9HAB3(Tbio)
UniProt: Q9HAB3
Position
8:144358552..144361272
AA seq 445 aa
MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNL
GLLVVTLWRRLAPGKDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFV
LALACCASNVTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGT
PGPPLDFLERFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGA
EEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARSACLLGLLAATNALTNGVLPAVQSF
SCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCGGYLMALAVLS
PCPPLVGTSAGVVLVVLSWVLCLGVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGA
VAMFPPTSIYHVFHSRKDCADPCDS
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcagcacccacgcccgcccgtccggtgctgacccacctgctggtggctctcttcggc
atgggctcctgggctgcggtcaatgggatctgggtggagctacctgtggtggtcaaagag
cttccagagggttggagcctcccctcttacgtctctgtgcttgtggctctggggaacctg
ggtctgctggtggtgaccctctggaggaggctggccccaggaaaggacgagcaggtcccc
atccgggtggtgcaggtgctgggcatggtgggcacagccctgctggcctctctgtggcac
catgtggccccagtggcaggacagttgcattctgtggccttcttagcactggcctttgtg
ctggcactggcatgctgtgcctcgaatgtcactttcctgcccttcttgagccacctgcca
cctcgcttcttacggtcattcttcctgggtcaaggcctgagtgccctgctgccctgcgtg
ctggccctagtgcagggtgtgggccgcctcgagtgcccgccagcccccatcaacggcacc
cctggccccccgctcgacttccttgagcgttttcccgccagcaccttcttctgggcactg
actgcccttctggtcgcttcagctgctgccttccagggtcttctgctgctgttgccgcca
ccaccatctgtacccacaggggagttaggatcaggcctccaggtgggagccccaggagca
gaggaagaggtggaagagtcctcaccactgcaagagccaccaagccaggcagcaggcacc
acccctggtccagaccctaaggcctatcagcttctatcagcccgcagtgcctgcctgctg
ggcctgttggccgccaccaacgcgctgaccaatggcgtgctgcctgccgtgcagagcttt
tcctgcttaccctacgggcgtctggcctaccacctggctgtggtgctgggcagtgctgcc
aatcccctggcctgcttcctggccatgggtgtgctgtgcaggtccttggcagggctgggc
ggcctctctctgctgggcgtgttctgtgggggctacctgatggcgctggcagtcctgagc
ccctgcccgcccctggtgggcacctcggcgggggtggtcctcgtggtgctgtcgtgggtg
ctgtgtcttggcgtgttctcctacgtgaaggtggcagccagctccctgctgcatggcggg
ggccggccggcattgctggcagccggcgtggccatccaggtgggctctctgctcggcgct
gttgctatgttccccccgaccagcatctatcacgtgttccacagcagaaaggactgtgca
gacccctgtgactcctga

DBGET integrated database retrieval system