KEGG   Homo sapiens (human): 79586
Entry
79586             CDS       T01001                                 

Gene name
CHPF, CHSY2, CSS2
Definition
(RefSeq) chondroitin polymerizing factor
  KO
K00747  chondroitin polymerizing factor [EC:2.4.1.175 2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    79586 (CHPF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    79586 (CHPF)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     79586 (CHPF)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     79586 (CHPF)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   79586 (CHPF)
SSDB
Motif
Pfam: CHGN Fringe
Other DBs
NCBI-GeneID: 79586
NCBI-ProteinID: NP_078812
OMIM: 610405
HGNC: 24291
Ensembl: ENSG00000123989
Vega: OTTHUMG00000058929
Pharos: Q8IZ52(Tbio)
UniProt: Q8IZ52
Position
2q35
AA seq 775 aa
MRASLLLSVLRPAGPVAVGISLGFTLSLLSVTWVEEPCGPGPPQPGDSELPPRGNTNAAR
RPNSVQPGAEREKPGAGEGAGENWEPRVLPYHPAQPGQAAKKAVRTRYISTELGIRQRLL
VAVLTSQTTLPTLGVAVNRTLGHRLERVVFLTGARGRRAPPGMAVVTLGEERPIGHLHLA
LRHLLEQHGDDFDWFFLVPDTTYTEAHGLARLTGHLSLASAAHLYLGRPQDFIGGEPTPG
RYCHGGFGVLLSRMLLQQLRPHLEGCRNDIVSARPDEWLGRCILDATGVGCTGDHEGVHY
SHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFARAELERTYQEIQELQWEIQ
NTSHLAVDGDQAAAWPVGIPAPSRPASRFEVLRWDYFTEQHAFSCADGSPRCPLRGADRA
DVADVLGTALEELNRRYHPALRLQKQQLVNGYRRFDPARGMEYTLDLQLEALTPQGGRRP
LTRRVQLLRPLSRVEILPVPYVTEASRLTVLLPLAAAERDLAPGFLEAFATAALEPGDAA
AALTLLLLYEPRQAQRVAHADVFAPVKAHVAELERRFPGARVPWLSVQTAAPSPLRLMDL
LSKKHPLDTLFLLAGPDTVLTPDFLNRCRMHAISGWQAFFPMHFQAFHPAVAPPQGPGPP
ELGRDTGRFDRQAASEACFYNSDYVAARGRLAAASEQEEELLESLDVYELFLHFSSLHVL
RAVEPALLQRYRAQTCSARLSEDLYHRCLQSVLEGLGSRTQLAMLLFEQEQGNST
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgcgggcatcgctgctgctgtcggtgctgcggcccgcagggcccgtggccgtgggcatc
tccctgggcttcaccctgagcctgctcagcgtcacctgggtggaggagccgtgcggccca
ggcccgccccaacctggagactctgagctgccgccgcgcggcaacaccaacgcggcgcgc
cggcccaactcggtgcagcccggagcggagcgcgagaagcccggggccggcgaaggcgcc
ggggagaattgggagccgcgcgtcttgccctaccaccctgcacagcccggccaggccgcc
aaaaaggccgtcaggacccgctacatcagcacggagctgggcatcaggcagaggctgctg
gtggcggtgctgacctctcagaccacgctgcccacgctgggcgtggccgtgaaccgcacg
ctggggcaccggctggagcgtgtggtgttcctgacgggcgcacggggccgccgggcccca
cctggcatggcagtggtgacgctaggcgaggagcgacccattggacacctgcacctggcg
ctgcgccacctgctggagcagcacggcgacgactttgactggttcttcctggtgcctgac
accacctacaccgaggcgcacggcctggcacgcctaactggccacctcagcctggcctcc
gccgcccacctgtacctgggccggccccaggacttcatcggcggagagcccacccccggc
cgctactgccacggaggctttggggtgctgctgtcgcgcatgctgctgcaacaactgcgc
ccccacctggaaggctgccgcaacgacatcgtcagtgcgcgccctgacgagtggctgggt
cgctgcattctcgatgccaccggggtgggctgcactggtgaccacgagggggtgcactat
agccatctggagctgagccctggggagccagtgcaggagggggaccctcatttccgaagt
gccctgacagcccaccctgtgcgtgaccctgtgcacatgtaccagctgcacaaagctttc
gcccgagctgaactggaacgcacgtaccaggagatccaggagttacagtgggagatccag
aataccagccatctggccgttgatggggaccaggcagctgcttggcccgtgggtattcca
gcaccatcccgcccggcctcccgctttgaggtgctgcgctgggactacttcacggagcag
cacgctttctcctgcgccgatggctcaccccgctgcccactgcgtggggctgaccgggct
gatgtggccgatgttctggggacagctctagaggagctgaaccgccgctaccacccggcc
ttgcggctccagaagcagcagctggtgaatggctaccgacgctttgatccggcccggggt
atggaatacacgctggacttgcagctggaggcactgaccccccagggaggccgccggccc
ctcactcgccgagtgcagctgctccggccgctgagccgcgtggagatcttgcctgtgccc
tatgtcactgaggcctcacgtctcactgtgctgctgcctctagctgcggctgagcgtgac
ctggcccctggcttcttggaggcctttgccactgcagcactggagcctggtgatgctgcg
gcagccctgaccctgctgctactgtatgagccgcgccaggcccagcgcgtggcccatgca
gatgtcttcgcacctgtcaaggcccacgtggcagagctggagcggcgtttccccggtgcc
cgggtgccatggctcagtgtgcagacagccgcaccctcaccactgcgcctcatggatcta
ctctccaagaagcacccgctggacacactgttcctgctggccgggccagacacggtgctc
acgcctgacttcctgaaccgctgccgcatgcatgccatctccggctggcaggccttcttt
cccatgcatttccaagccttccacccagctgtggccccaccacaagggcctgggccccca
gagctgggccgtgacactggccgctttgatcgccaggcagccagcgaggcctgcttctac
aactccgactatgtggcagcccgtgggcgcctggcggcagcctcagaacaagaagaggag
ctgctggagagcctggatgtgtacgagctgttcctccacttctccagtctgcatgtgctg
cgggcggtggagccggcgctgctgcagcgctaccgggcccagacgtgcagcgcgaggctc
agtgaggacctgtaccaccgctgcctccagagcgtgcttgagggcctcggctcccgaacc
cagctggccatgctactctttgaacaggagcagggcaacagcacctga

DBGET integrated database retrieval system