KEGG   Homo sapiens (human): 79587Help
Entry
79587             CDS       T01001                                 

Gene name
CARS2, COXPD27, cysRS
Definition
(RefSeq) cysteinyl-tRNA synthetase 2, mitochondrial
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    79587 (CARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    79587 (CARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    79587 (CARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     79587 (CARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   79587 (CARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    79587 (CARS2)
 Prokaryotic Type
    79587 (CARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 79587
NCBI-ProteinID: NP_078813
OMIM: 612800
HGNC: 25695
Ensembl: ENSG00000134905
Vega: OTTHUMG00000017347
Pharos: Q9HA77(Tdark)
UniProt: Q9HA77 B7Z7E6
Position
13q34
AA seq 564 aa AA seqDB search
MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTG
RKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITD
VDDKIIKRANEMNISPASLASLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGII
ARGNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALWKAAKPQEV
FWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWG
NYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAM
LQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVV
DAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSE
ATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINI
KDRSSTTSTWELLDQRTKDQKSAG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggactacgcgcggcccaggcctgggccccccgctgctccaggccgcgctgggc
cttgggcgggctgggtggcactggcctgcgggccgggcggcgagcggggggcgcgggcgg
gcctggctgcagcccacgggccgggagacgggtgtgcaggtgtacaacagcctcaccggg
aggaaggaacccctaatcgtggcgcacgccgaagccgcctcctggtatagctgtggacca
actgtatatgatcatgcgcaccttggccatgcttgctcatatgttagatttgatatcatt
cgaaggatcctaaccaaggtttttggatgcagcatagtcatggtgatgggtattacagat
gtagatgataaaatcatcaaaagagccaatgagatgaatatttcccccgcttccctcgcc
agtctttatgaggaagacttcaagcaggacatggcagccctgaaggttctcccacccacg
gtgtacctgagggtaaccgaaaatattcctcagataatttctttcattgaaggaatcatt
gctcgtgggaacgcttattcaacggcaaaaggcaatgtctacttcgatctgaagtctaga
ggagacaagtatggcaaattggtcggcgtggtccctggtccagtcggagagccagcggac
tctgacaagcgtcatgccagtgacttcgccctgtggaaggcggccaaaccccaggaggtg
ttctgggcctctccctggggacccgggaggccgggctggcacatcgagtgctctgccatc
gctagtatggtatttggaagtcaactggatatccattcaggtgggatagatttagctttt
ccacatcatgaaaacgaaattgcacagtgcgaagtctttcatcagtgcgagcagtgggga
aattattttctgcattctgggcatttgcacgccaaaggcaaagaagaaaaaatgtccaaa
tcattaaagaactacattactattaaggactttctgaagaccttttcccccgatgtcttc
cggttcttctgcctgcggagcagctaccgctcagccatcgactacagtgacagcgccatg
ctccaagctcagcagctgctcctggggctgggctctttcctggaggacgcacgtgcctac
atgaaggggcagctggcctgcggctccgtcagggaagcgatgctgtgggagaggctctcc
agcaccaagagggccgtgaaggcggccttggcagatgattttgacacacccagggtggtt
gatgccatcctgggccttgcacaccacgggaatggacagctcagggcgtccctgaaggaa
cctgaagggccgagaagtcctgctgtgtttggtgccatcatctcttactttgaacagttt
tttgaaactgttggaatttctctggcaaatcaacagtacgtttcaggagacggcagcgag
gctaccttgcatggtgtggtggacgagctggtgcggttccggcagaaggtccggcagttt
gcgctggccatgcccgaggccacgggggacgcccggcggcagcagctcctagaaaggcag
cccctgctggaagcatgcgacaccctgcgccggggcctgactgcccacggcatcaacatc
aaggacagaagcagtacaacatccacgtgggaactgctggatcaaaggacaaaagaccaa
aaatcagcgggctga

DBGET integrated database retrieval system