KEGG   Homo sapiens (human): 79590
Entry
79590             CDS       T01001                                 

Gene name
MRPL24, L24mt, MRP-L18, MRP-L24
Definition
(RefSeq) mitochondrial ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    79590 (MRPL24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    79590 (MRPL24)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    79590 (MRPL24)
  Bacteria
    79590 (MRPL24)
  Archaea
    79590 (MRPL24)
SSDB
Motif
Pfam: ribosomal_L24 KOW
Other DBs
NCBI-GeneID: 79590
NCBI-ProteinID: NP_078816
OMIM: 611836
HGNC: 14037
Ensembl: ENSG00000143314
Vega: OTTHUMG00000041296
Pharos: Q96A35(Tdark)
UniProt: Q96A35
Structure
PDB: 
5OOM 5OOL 3J7Y 3IY9

Position
1q23.1
AA seq 216 aa
MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGD
TVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQV
KLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVE
DALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcgtctttctgccctgctggccttggcatccaaggtcactctgcccccccattaccgc
tatgggatgagccccccaggctctgttgcagacaagaggaagaaccccccatggatcagg
cggcgcccagtggttgtggaacccatctctgatgaagactggtatctgttctgtggggac
acggtggagatcctagaaggcaaggatgccgggaagcagggcaaagtggttcaagttatc
cggcagcgaaactgggtggtcgtgggagggctgaacacacattaccgctacattggcaag
accatggattaccggggaaccatgatccctagtgaagcccccttgctccaccgccaggtc
aaacttgtggatcctatggacaggaaacccactgagatcgagtggagatttactgaagca
ggagagcgggtacgagtctccacacgatcagggagaattatccctaaacccgaatttccc
agagctgatggcatcgtccctgaaacgtggattgatggccccaaagacacatcagtggaa
gatgctttagaaagaacctatgtgccctgtctaaagacactgcaggaggaggtgatggag
gccatggggatcaaggagacccggaaatacaagaaggtctattggtattga

DBGET integrated database retrieval system