KEGG   Homo sapiens (human): 79602Help
Entry
79602             CDS       T01001                                 

Gene name
ADIPOR2, ACDCR2, PAQR2
Definition
(RefSeq) adiponectin receptor 2
  KO
K07297  adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    79602 (ADIPOR2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    79602 (ADIPOR2)
  09149 Aging
   04211 Longevity regulating pathway
    79602 (ADIPOR2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    79602 (ADIPOR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HlyIII PRR18
Motif
Other DBs
NCBI-GeneID: 79602
NCBI-ProteinID: NP_078827
OMIM: 607946
HGNC: 24041
Ensembl: ENSG00000006831
Vega: OTTHUMG00000130139
Pharos: Q86V24(Tbio)
UniProt: Q86V24
Structure
PDB: 

Position
12p13.33
AA seq 386 aa AA seqDB search
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE
EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF
VHFHGVSNLQEFRFMIGGGCSEEDAL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagccaacagaaaaccgattggggtgcagcaggactccagagccagatataagg
ctcagaaaagggcaccaactggatggtacacgaagaggtgataatgacagccaccaagga
gatttggagcccattttagaggcatctgttctatcttcccatcataaaaaaagctctgag
gaacatgaatacagtgatgaagctcctcaggaagatgagggctttatgggcatgtcccct
ctcttacaagcccatcatgctatggaaaaaatggaagaatttgtttgtaaggtatgggaa
ggtcggtggcgagtgatccctcatgatgtactaccagactggctcaaggataatgacttc
ctcttgcatggacaccggcctcctatgccttctttccgggcctgttttaagagcattttc
agaatacacacagaaacaggcaacatttggacacatctcttaggttgtgtattcttcctg
tgcctggggatcttttatatgtttcgcccaaatatctcctttgtggcccctctgcaagag
aaggtggtctttggattatttttcttaggagccattctctgcctttctttttcatggctc
ttccacacagtctactgccactcagagggggtctctcggctcttctctaaactggattac
tctggtattgctcttctgattatgggaagttttgttccttggctttattattctttctac
tgtaatccacaaccttgcttcatctacttgattgtcatctgtgtgctgggcattgcagcc
attatagtctcccagtgggacatgtttgccacccctcagtatcggggagtaagagcagga
gtgtttttgggcctaggcctgagtggaatcattcctaccttgcactatgtcatctcggag
gggttccttaaggccgccaccatagggcagataggctggttgatgctgatggccagcctc
tacatcacaggagctgccctgtatgctgcccggatccccgaacgctttttccctggcaaa
tgtgacatctggtttcactctcatcagctgtttcatatctttgtggttgctggagctttt
gttcacttccatggtgtctcaaacctccaggagtttcgtttcatgatcggcgggggctgc
agtgaagaggatgcactgtga

DBGET integrated database retrieval system