KEGG   Homo sapiens (human): 79603Help
Entry
79603             CDS       T01001                                 

Gene name
CERS4, LASS4, Trh1
Definition
(RefSeq) ceramide synthase 4
  KO
K04710  ceramide synthetase [EC:2.3.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    79603 (CERS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    79603 (CERS4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     79603 (CERS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Motif
Other DBs
NCBI-GeneID: 79603
NCBI-ProteinID: NP_078828
OMIM: 615334
HGNC: 23747
Ensembl: ENSG00000090661
Vega: OTTHUMG00000172570
Pharos: Q9HA82(Tbio)
UniProt: Q9HA82 Q53HF9
Position
19p13.2
AA seq 394 aa AA seqDB search
MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFI
GLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRR
RRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLY
WWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHD
SSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFF
GYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPL
QLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccagtttcaacgagtggttttggcaggacaggttctggttaccacccaatgtc
acgtggacagagctagaagaccgggatggccgtgtctacccccacccccaggacttgttg
gcagccctgcccctggcgctggtcctcctggccatgcgccttgcctttgagagattcatt
ggcctgcccctgagccggtggctgggtgtgagggatcagaccaggaggcaagtgaagccc
aacgccacgctggagaaacacttcctcacggaagggcacaggcccaaggagccccagctg
tctctcctggccgcccagtgtggcctcacgctgcagcagacccagcgatggttccggaga
cgccggaaccaggatcgaccccagctgaccaagaagttctgtgaggccagctggaggttt
ctcttctacctgtcctccttcgtgggcggcctctcggtcctgtaccacgagtcatggctg
tgggcaccagtaatgtgctgggacaggtacccaaaccagactctgaagccatccctgtac
tggtggtacctcttggagctgggtttctacctctcactgctaatcaggctgccctttgat
gtcaagcgcaaggatttcaaggagcaggtgatacaccacttcgtggcggtcatcctgatg
accttctcctacagtgccaacctgctgcgcattggctctctggtgctgctgttacacgat
tcctctgactacctgctggaggcctgtaagatggtcaactacatgcagtatcagcaagtg
tgcgacgctctcttcctcatcttctcctttgtcttcttctacacccgactggtcctcttt
cccacccagatcctctacaccacatactacgagtccatcagcaacaggggccccttcttc
ggctactacttcttcaacgggcttctgatgttgctgcagctgctgcacgtgttctggtct
tgcctcattctgcgcatgctctatagcttcatgaagaagggccagatggagaaggacatt
cgtagtgatgtagaagaatcagactccagtgaggaggcggcggcggcccaggaacctctg
cagctaaagaacggggcagctggagggcccaggccagcccccactgatggccctcggagc
cgggtggccgggcgtctgaccaacaggcacacaacagccacatag

DBGET integrated database retrieval system