KEGG   Homo sapiens (human): 79607
Entry
79607             CDS       T01001                                 
Symbol
FAM118B
Name
(RefSeq) family with sequence similarity 118 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SIR2_2 DUF5443
Other DBs
NCBI-GeneID: 79607
NCBI-ProteinID: NP_078832
OMIM: 616587
HGNC: 26110
Ensembl: ENSG00000197798
Pharos: Q9BPY3(Tdark)
UniProt: Q9BPY3 A0A024R3L8
Position
11:126211724..126262987
AA seq 351 aa
MASTGSQASDIDEIFGFFNDGEPPTKKPRKLLPSLKTKKPRELVLVIGTGISAAVAPQVP
ALKSWKGLIQALLDAAIDFDLLEDEESKKFQKCLHEDKNLVHVAHDLIQKLSPRTSNVRS
TFFKDCLYEVFDDLESKMEDSGKQLLQSVLHLMENGALVLTTNFDNLLELYAADQGKQLE
SLDLTDEKKVLEWAQEKRKLSVLHIHGVYTNPSGIVLHPAGYQNVLRNTEVMREIQKLYE
NKSFLFLGCGWTVDDTTFQALFLEAVKHKSDLEHFMLVRRGDVDEFKKLRENMLDKGIKV
ISYGDDYADLPEYFKRLTCEISTRGTSAGMVREGQLNGSSAAHSEIRGCST
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcttctacagggagccaggcctctgatatagacgagatttttggattcttcaacgat
ggcgaacctcccaccaaaaagcccaggaagctgcttccaagcttaaaaactaagaagcct
cgagaacttgtgctagtgattggaacaggcattagtgctgcagttgcgccccaagttcca
gccctcaaatcctggaaggggttaattcaggccttactggatgctgccattgattttgat
cttttagaagatgaggagagcaaaaagtttcagaaatgtctccatgaagacaagaacctg
gtccatgttgcccatgaccttatccagaaactctctcctcgtaccagtaatgttcgatcc
acatttttcaaggactgtttatatgaagtatttgatgacttggagtcaaagatggaagat
tctggaaaacagctacttcagtcagttctccacctgatggaaaatggagccctcgtatta
actacaaattttgataatctcttggaactgtatgcagcagatcaggggaaacagcttgaa
tcccttgaccttactgatgagaaaaaggtcctcgagtgggctcaggagaagcgtaagctg
agcgtgttgcatattcacggagtctacaccaaccctagtggcattgtccttcatccggct
ggatatcagaacgtgctcaggaacactgaagtcatgagagaaattcagaaactctacgaa
aacaagtcatttcttttcctgggctgtggctggactgtggatgacaccactttccaggcc
cttttcttggaggctgtcaagcataaatctgacctagaacatttcatgctggttcggaga
ggagacgtagatgagttcaaaaagcttcgagaaaacatgctggacaaggggattaaagtc
atctcctatggagatgactatgccgatcttccagaatatttcaagcgactgacatgtgag
atctccacaaggggtacatcagcagggatggtgagagaaggtcagctaaatggctcatct
gcagcacacagtgaaataagaggctgtagtacatga

DBGET integrated database retrieval system