KEGG   Homo sapiens (human): 79609Help
Entry
79609             CDS       T01001                                 

Gene name
VCPKMT, C14orf138, METTL21D, VCP-KMT
Definition
(RefSeq) valosin containing protein lysine methyltransferase
  KO
K21806  protein N-lysine methyltransferase METTL21D [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    79609 (VCPKMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     79609 (VCPKMT)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     79609 (VCPKMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_16 Methyltransf_23 Methyltransf_25 Cons_hypoth95 MTS Methyltransf_11 PrmA
Motif
Other DBs
NCBI-GeneID: 79609
NCBI-ProteinID: NP_078834
OMIM: 615260
HGNC: 20352
Ensembl: ENSG00000100483
Vega: OTTHUMG00000029531
Pharos: Q9H867(Tdark)
UniProt: Q9H867
Structure
PDB: 

Position
14q21.3
AA seq 229 aa AA seqDB search
MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSG
DGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQ
AKVLKWGEEIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGK
NPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFPS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcggatacgctggagtcctcgctggaggacccactgcggagctttgtgcgagttttg
gagaagcgggatggtacagtgctacgactacagcagtatagctccggtggcgtgggttgc
gttgtgtgggacgctgccattgtcctttctaaatacctggaaacgcccgagttttctggc
gacggggcccacgcgctgagccggcggtcggtgctggagctgggttcgggcaccggggcc
gtggggctcatggctgctaccctcggggctgatgttgtagtcaccgatcttgaggaattg
caagacttgctgaagatgaatattaatatgaacaagcatcttgtcactggttctgttcaa
gccaaggtactgaaatggggggaagaaatagaaggctttccttctccacccgacttcata
ctgatggccgactgcatatactatgaagagtctttggagccattgctgaaaactctaaaa
gatatcagcggatttgaaacttgtattatatgttgttatgaacaacgaacaatggggaaa
aatccagaaattgagaaaaaatattttgagctccttcagctagattttgactttgaaaaa
attcctttggaaaaacatgatgaagagtatcgaagtgaagatattcatattatatacatc
agaaagaaaaaatcgaaatttccatcgtga

DBGET integrated database retrieval system