KEGG   Homo sapiens (human): 79621
Entry
79621             CDS       T01001                                 

Symbol
RNASEH2B, AGS2, DLEU8
Name
(RefSeq) ribonuclease H2 subunit B
  KO
K10744  ribonuclease H2 subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Disease
H00290  Aicardi-Goutieres syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    79621 (RNASEH2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    79621 (RNASEH2B)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    79621 (RNASEH2B)
SSDB
Motif
Pfam: RNase_H2-Ydr279 Ydr279_N
Other DBs
NCBI-GeneID: 79621
NCBI-ProteinID: NP_078846
OMIM: 610326
HGNC: 25671
Ensembl: ENSG00000136104
Vega: OTTHUMG00000016937
Pharos: Q5TBB1(Tbio)
UniProt: Q5TBB1 Q8N451
Structure
PDB: 
3P87 3PUF 3P56

Position
13q14.3
AA seq 312 aa
MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQL
FEVKVFKEKHHSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDN
VFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKT
NNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAHGLISDYIPKELSDDLSKYLKLPEPSAS
LPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSKMTAAQKALAKVDKSGMKSIDTF
FGVKNKKKIGKV
NT seq 939 nt   +upstreamnt  +downstreamnt
atggccgctggcgtggactgcggggacggggttggcgcccggcagcacgtgttcctggtt
tcagaatatttaaaagatgcttcaaagaagatgaaaaatgggctaatgtttgtaaaactg
gttaacccctgttcaggagaaggagccatttacttgttcaatatgtgtctacagcagctg
tttgaagtaaaagttttcaaggaaaaacaccattcttggtttataaatcaatcagttcaa
tcaggaggtcttctccattttgccacacctgtggatcctctatttctgcttctccactac
ctcataaaggctgataaggaggggaagtttcagccccttgatcaagttgtggtggataac
gtgtttccaaattgcatcttgttgctgaaacttcctggacttgagaagttacttcatcat
gtgacagaggaaaaaggtaatccagaaatagacaacaagaaatattacaagtacagcaaa
gagaagacattaaagtggctggaaaaaaaggttaatcaaactgtggcagcattaaaaacc
aataatgtgaatgtcagttcccgggtacagtcaactgcatttttctctggtgaccaagct
tccactgacaaggaagaggattatattcgttatgcccatggtctgatatctgactacatc
cctaaagaattaagtgatgacttatctaaatacttaaagcttccagaaccttcagcctca
ttgccaaatcctccatcaaagaaaataaagttatcagatgagcctgtagaagcaaaagaa
gattacactaagtttaatactaaagatttgaagactgaaaagaaaaatagcaaaatgact
gcagctcagaaggctttggctaaagttgacaagagtggaatgaaaagtattgataccttt
tttggggtaaaaaataaaaaaaaaattggaaaggtttga

DBGET integrated database retrieval system