KEGG   Homo sapiens (human): 79622
Entry
79622             CDS       T01001                                 

Gene name
SNRNP25, C16orf33
Definition
(RefSeq) small nuclear ribonucleoprotein U11/U12 subunit 25
  KO
K13153  U11/U12 small nuclear ribonucleoprotein 25 kDa protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    79622 (SNRNP25)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome specific factors
    79622 (SNRNP25)
SSDB
Motif
Pfam: Ubiquitin_4 ubiquitin
Other DBs
NCBI-GeneID: 79622
NCBI-ProteinID: NP_078847
HGNC: 14161
Ensembl: ENSG00000161981
Vega: OTTHUMG00000060720
Pharos: Q9BV90(Tdark)
UniProt: Q9BV90 Q4TT61
Position
16p13.3
AA seq 123 aa
MVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKA
IQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKL
RQK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggtggtgcaggacccgctgctctgcgatctgccgatccaggttactctggaagaagtc
aactcccaaatagccctagaatacggccaggcaatgacggtccgagtgtgcaagatggat
ggagaagtaatgcccgtggttgtagtgcagagtgccacagtcctggacctgaagaaggcc
atccagagatacgtgcagctcaagcaggagcgtgaagggggcattcagcacatcagctgg
tcctacgtgtggaggacgtaccatctgacctctgcaggagagaaactcacggaagacaga
aagaagctccgagactacggcatccggaatcgagacgaggtttccttcatcaaaaagctg
aggcaaaagtga

DBGET integrated database retrieval system