KEGG   Homo sapiens (human): 79627
Entry
79627             CDS       T01001                                 
Symbol
OGFRL1, dJ331H24.1
Name
(RefSeq) opioid growth factor receptor like 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: OGFr_N bpX0
Other DBs
NCBI-GeneID: 79627
NCBI-ProteinID: NP_078852
HGNC: 21378
Ensembl: ENSG00000119900
Pharos: Q5TC84(Tdark)
UniProt: Q5TC84
Position
6:71288811..71309059
AA seq 451 aa
MGNLLGGVSFREPTTVEDCDSTWQTDSEPEPEEPGPGGGSEGPGQESEQPAQPPEQAGGR
PGASPAPDEDAEAAGAEQGGDSTEATAKPKRSFYAARDLYKYRHQYPNFKDIRYQNDLSN
LRFYKNKIPFKPDGVYIEEVLSKWKGDYEKLEHNHTYIQWLFPLREQGLNFYAKELTTYE
IEEFKKTKEAIRRFLLAYKMMLEFFGIKLTDKTGNVARAVNWQERFQHLNESQHNYLRIT
RILKSLGELGYESFKSPLVKFILHEALVENTIPNIKQSALEYFVYTIRDRRERRKLLRFA
QKHYTPSENFIWGPPRKEQSEGSKAQKMSSPLASSHNSQTSMHKKAKDSKNSSSAVHLNS
KTAEDKKVAPKEPVEETDRPSPEPSNEAAKPRNTEKDSNAENMNSQPEKTVTTPTEKKES
VSPENNEEGGNDNQDNENPGNTNCHDVVLVQ
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgggcaacctgctcggcggggtcagcttccgcgagcccaccaccgtggaggactgcgac
tccacctggcagaccgactcggagcccgagcccgaagaaccagggccgggcggcggcagc
gagggcccggggcaggagtccgagcagcccgcgcagcccccggagcaagccggcgggcgg
cccggcgccagccccgcgccggacgaggacgccgaggcggcgggcgccgagcagggtggt
gattccactgaagcaactgccaaaccaaagagaagtttttatgctgccagggatttgtac
aagtaccgacaccagtacccaaacttcaaagatatccgatatcaaaatgacttgagcaat
cttcgtttttataagaataaaattccattcaagccagatggtgtttacattgaagaagtt
ctaagtaaatggaaaggagattatgaaaaactggagcacaaccacacttacattcaatgg
cttttccccctgagagaacaaggcttgaacttctatgccaaagaactaactacatatgaa
attgaggaattcaaaaaaacaaaagaagcaattagaagattcctcctggcttataaaatg
atgctagaattttttggaataaaactgactgataaaactggaaatgttgctcgggctgtt
aactggcaggaaagatttcagcatctgaatgagtcccagcacaactatttaagaatcact
cgtattcttaaaagccttggtgagcttggatatgaaagttttaaatctcctcttgtaaaa
tttattcttcatgaagctcttgtggagaatactattcccaatattaagcagagtgctcta
gagtattttgtttatacaattagagacagaagagaaaggagaaagctcctgcggttcgcc
cagaaacactacacgccttcagagaactttatctggggaccgcctcgaaaagaacagtcg
gagggaagcaaagcccagaaaatgtcttcccctctcgcctccagtcataacagtcaaact
tctatgcacaaaaaagccaaggactccaaaaattcctcctcagctgttcatttaaatagc
aaaacagctgaagacaaaaaagtggcaccaaaagagcctgtggaagagacagacaggccc
agcccagagcccagcaatgaagctgccaagccaagaaatacagagaaggacagtaatgct
gagaacatgaattctcaacctgagaaaacagttactactcccacagaaaaaaaggagagt
gtatctcctgagaataacgaagaaggtggaaatgataaccaagacaatgaaaatcctgga
aatacaaattgccatgatgttgtactagtacagtga

DBGET integrated database retrieval system