KEGG   Homo sapiens (human): 79632
Entry
79632             CDS       T01001                                 
Symbol
FAM184A, C6orf60
Name
(RefSeq) family with sequence similarity 184 member A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM184
Other DBs
NCBI-GeneID: 79632
NCBI-ProteinID: NP_078857
HGNC: 20991
Ensembl: ENSG00000111879
Pharos: Q8NB25(Tdark)
UniProt: Q8NB25 Q6P9G8
Position
6:complement(118959763..119149128)
AA seq 1140 aa
MATPGMSWQQHYYGGSAAKFAPSPATAQLAGHSMDYSQEMHLKMSKKIAQLTKVIYALNT
KNDEHESAIQALKDAHEEEIQQILAETREKILQYKSKVTEELDLRRKIQVLESSLEDHIK
MKQQALTEFEAYKHRVEDMQLCAEAQHVQRIVTMSREVEEIRRKFEEKLRSFGQLQVQFE
KDKRLALEDLQAAHRREIQELLKSQQDHSASVNKGQEKAEELHRMEVESLNKMLEELRLE
RKKLIEDYEGKLNKAQSFYERELDTLKRSQLFTAESLQASKEKEADLRKEFQGQEAILRK
TIGKLKTELQMVQDEAGSLLDKCQKLQTALAIAENNVQVLQKQLDDAKEGEMALLSKHKE
VESELAAARERLQQQASDLVLKASHIGMLQATQMTQEVTIKDLESEKSRVNERLSQLEEE
RAFLRSKTQSLDEEQKQQILELEKKVNEAKRTQQEYYERELKNLQSRLEEEVTQLNEAHS
KTLEELAWKHHMAIEAVHSNAIRDKKKLQMDLEEQHNKDKLNLEEDKNQLQQELENLKEV
LEDKLNTANQEIGHLQDMVRKSEQGLGSAEGLIASLQDSQERLQNELDLTKDSLKETKDA
LLNVEGELEQERQQHEETIAAMKEEEKLKVDKMAHDLEIKWTENLRQECSKLREELRLQH
EEDKKSAMSQLLQLKDREKNAARDSWQKKVEDLLNQISLLKQNLEIQLSQSQTSLQQLQA
QFTQERQRLTQELEELEEQHQQRHKSLKEAHVLAFQTMEEEKEKEQRALENHLQQKHSAE
LQSLKDAHRESMEGFRIEMEQELQTLRFELEDEGKAMLASLRSELNHQHAAAIDLLRHNH
HQELAAAKMELERSIDISRRQSKEHICRITDLQEELRHREHHISELDKEVQHLHENISAL
TKELEFKGKEILRIRSESNQQIRLHEQDLNKRLEKELDVMTADHLREKNIMRADFNKTNE
LLKEINAALQVSLEEMEEKYLMRESKPEDIQMITELKAMLTERDQIIKKLIEDNKFYQLE
LVNRETNFNKVFNSSPTVGVINPLAKQKKKNDKSPTNRFVSVPNLSALESGGVGNGHPNR
LDPIPNSPVHDIEFNSSKPLPQPVPPKGPKTFLSPAQSEASPVASPDPQRQEWFARYFTF
NT seq 3423 nt   +upstreamnt  +downstreamnt
atggcgaccccgggcatgagctggcagcagcactattacggcggctcggcggccaaattc
gcgccctcgccggccaccgcacagctggctgggcacagcatggactacagccaggagatg
cacctgaaaatgagcaagaaaatcgcccagctcaccaaggtaatatatgctttaaacact
aaaaatgatgagcatgaatctgcaattcaagccctcaaagatgctcatgaagaagaaatt
caacaaattcttgctgaaacaagagaaaaaatattgcagtataaaagcaaagtaacagag
gagctagaccttagaagaaagattcaagttttagaatcatcattagaagatcacataaaa
atgaagcagcaggctttgacagaatttgaagcttataagcacagagttgaggacatgcaa
ctttgtgcagaagcccagcatgtccaacgcatagtgaccatgtctagagaagtcgaagag
attagaaggaaatttgaagaaaaattacggagctttggacaacttcaagtacagtttgaa
aaagacaaacgattggcattggaagacttgcaagctgctcacagacgggagatacaagag
ctattgaagtcacagcaggatcacagtgcctcagtaaataaaggccaggaaaaggcagag
gaactacacagaatggaggtggagtccctaaacaaaatgcttgaggagctaagacttgaa
cggaagaaactaattgaggattatgaaggcaagttgaataaagctcagtccttttatgaa
cgtgagcttgatactttgaaaaggtcacagctttttacagcagaaagcctacaggccagc
aaagaaaaggaagctgatcttagaaaagaatttcagggacaagaagcaattttacgaaaa
actataggaaaattaaagacagagttacagatggtacaggatgaagctggaagtcttctt
gacaaatgccaaaagcttcagacggcacttgccatagcagagaacaatgttcaggttctt
caaaaacagcttgatgatgccaaggagggagaaatggccctattaagcaagcacaaagaa
gtggaaagtgagctagcagctgccagagaacgtttacaacagcaagcttcagatcttgtc
ctcaaagctagtcatattggaatgcttcaagcaactcaaatgacccaggaagttacaatt
aaagatttagaatcagaaaaatcgagagtcaatgagagattatctcaacttgaagaggaa
agagcttttttgcgaagcaaaacccaaagtctggatgaagagcagaagcaacagattcta
gaactggagaagaaagtaaatgaagcaaagagaactcagcaagaatattatgaaagggaa
cttaaaaacctgcaaagtagattggaagaggaggtgactcaattaaacgaggcccattct
aagactttggaagaattagcttggaagcaccatatggcaattgaagctgtccacagtaat
gcaattagggataagaaaaaactgcaaatggatttggaagaacaacataacaaagataaa
ctaaacctggaagaggataaaaatcagcttcaacaagagctagaaaacctaaaggaagta
ctggaagacaagttgaatacagccaatcaagagattggccacctccaagatatggtaagg
aaaagtgaacaaggtcttggctctgcagaaggacttattgctagtcttcaggactcccag
gaaaggcttcagaatgagcttgacttgactaaagacagcctaaaggagaccaaggatgct
ctattaaatgtggagggtgagctagaacaagaaaggcaacagcatgaagaaacaattgct
gccatgaaagaagaagagaagctcaaagtggacaaaatggcccatgacttagaaattaag
tggactgaaaatcttagacaagagtgttctaaacttcgtgaagagttaaggcttcaacat
gaagaggataagaagtcagcaatgtctcaacttttgcagttgaaagatcgagagaaaaat
gcagcaagagattcatggcagaagaaagtagaagatctcttaaaccagatttccttgctg
aaacagaatctggagatacagctttcccagtctcagacttctttgcaacaactgcaagcc
cagtttacgcaagaacgacagcggcttacgcaagagcttgaagaattagaggagcaacat
cagcaaagacacaaatcattaaaagaagcacatgtccttgcatttcaaactatggaagag
gaaaaggaaaaggagcaaagagctcttgaaaatcatttacaacagaagcattctgcagag
cttcaatcactaaaagatgcacacagagagtcaatggagggcttccggatagaaatggaa
caggaacttcagactcttcggtttgaattagaagatgaaggaaaggctatgcttgcttcc
ttgcgctcagaactcaaccatcaacatgcagctgcaattgatttgttacggcataatcat
catcaagaattggcagctgctaaaatggaattagagagaagcatagacatcagcagaaga
cagagtaaggagcacatatgtagaattacagatctacaagaggaattaagacacagagag
catcacatctctgaattggataaggaggttcagcaccttcatgagaatataagtgcccta
accaaagaactggaatttaaggggaaagaaattctcagaatacgaagtgaatctaaccaa
cagataaggttgcatgaacaagatttaaacaagagacttgaaaaagagttggatgtcatg
acagcagaccacctcagagagaaaaatatcatgcgggcagattttaataagactaacgag
ctactcaaggaaataaatgccgctttacaagtgtcattagaagaaatggaagaaaaatat
ctaatgagagaatcaaaaccagaagatatacagatgattacagaattaaaagccatgctt
acagaaagagaccagatcataaagaaactaattgaggataataagttttatcagctggaa
ttagtcaatcgagaaactaacttcaacaaagtgtttaactcaagtcctactgttggtgtt
attaatccattggctaagcaaaagaagaagaatgataaatcaccaacaaacaggtttgtg
agtgttcccaatctaagtgctctggaatctggtggagtgggcaatggacatcctaaccgc
ctggatcccattcctaattctccagtccacgatattgagttcaacagcagcaaaccactt
ccacagccagtgccacctaaagggcccaagacatttttgagtcctgctcagagtgaagct
tctccagtggcttctccagatccccagcgccaggagtggtttgcccggtacttcacattc
tga

DBGET integrated database retrieval system